BLASTX nr result
ID: Wisteria21_contig00037398
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00037398 (444 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007150840.1| hypothetical protein PHAVU_005G185300g [Phas... 187 3e-45 ref|XP_014501192.1| PREDICTED: putative pentatricopeptide repeat... 183 4e-44 gb|KRG93487.1| hypothetical protein GLYMA_19G019400 [Glycine max] 183 5e-44 ref|XP_006603851.1| PREDICTED: putative pentatricopeptide repeat... 183 5e-44 ref|XP_006601680.1| PREDICTED: putative pentatricopeptide repeat... 181 1e-43 ref|XP_012567467.1| PREDICTED: putative pentatricopeptide repeat... 174 2e-41 ref|XP_012574783.1| PREDICTED: putative pentatricopeptide repeat... 167 4e-39 gb|KHN34202.1| Putative pentatricopeptide repeat-containing prot... 149 1e-33 ref|XP_009379228.1| PREDICTED: putative pentatricopeptide repeat... 139 8e-31 ref|XP_008380383.1| PREDICTED: putative pentatricopeptide repeat... 139 8e-31 ref|XP_012066581.1| PREDICTED: putative pentatricopeptide repeat... 137 4e-30 ref|XP_011659004.1| PREDICTED: putative pentatricopeptide repeat... 135 2e-29 ref|XP_008342596.1| PREDICTED: putative pentatricopeptide repeat... 134 2e-29 ref|XP_012460470.1| PREDICTED: putative pentatricopeptide repeat... 132 8e-29 ref|XP_008445574.1| PREDICTED: putative pentatricopeptide repeat... 132 8e-29 ref|XP_003621961.1| PPR containing plant-like protein, putative ... 129 7e-28 ref|XP_008227981.1| PREDICTED: putative pentatricopeptide repeat... 128 1e-27 ref|XP_007217131.1| hypothetical protein PRUPE_ppa015612m2g, par... 127 4e-27 ref|XP_007011398.1| Pentatricopeptide repeat superfamily protein... 126 7e-27 ref|XP_007011397.1| Pentatricopeptide repeat superfamily protein... 126 7e-27 >ref|XP_007150840.1| hypothetical protein PHAVU_005G185300g [Phaseolus vulgaris] gi|561024104|gb|ESW22834.1| hypothetical protein PHAVU_005G185300g [Phaseolus vulgaris] Length = 653 Score = 187 bits (474), Expect = 3e-45 Identities = 101/161 (62%), Positives = 121/161 (75%), Gaps = 14/161 (8%) Frame = -1 Query: 444 LIALSFFLWSAQRRRHGSLAVDHMLLVLARLTHRYKTLETILSHLESIGSRSLTNPNSFL 265 LIALSFFLW+AQRRRH L +DH++ VL RLTHRY T+ ILS L+SIG SL NP S L Sbjct: 55 LIALSFFLWTAQRRRHHLLPLDHIVTVLRRLTHRYNTVSAILSELDSIGCASLRNPKSQL 114 Query: 264 LLLRIFWRAGMHAMLLQAYHLMQ-SHGFVPNTFARNLLMDSLFRIGQPQ--LAFSVFENT 94 +LLR++WRAGM+ M+++AY MQ ++GFVP+TFARNLLMD LFR G L+ S+F++T Sbjct: 115 VLLRVYWRAGMYDMVVEAYEQMQGAYGFVPDTFARNLLMDVLFRTGHSHVALSLSLFDHT 174 Query: 93 HPPNFFTFNIALLHLSN--------SNHLPY---ILRLMLR 4 HPPNFFTFNIAL HLSN N LPY ILRLMLR Sbjct: 175 HPPNFFTFNIALFHLSNFNLKKMHTHNTLPYFSPILRLMLR 215 >ref|XP_014501192.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Vigna radiata var. radiata] Length = 656 Score = 183 bits (465), Expect = 4e-44 Identities = 94/151 (62%), Positives = 113/151 (74%), Gaps = 10/151 (6%) Frame = -1 Query: 444 LIALSFFLWSAQRRRHGSLAVDHMLLVLARLTHRYKTLETILSHLESIGSRSLTNPNSFL 265 LIALS FLW+AQRRRH A+DH++ VL RLTHRY T+ LS L+SIG SLTNP S L Sbjct: 59 LIALSLFLWTAQRRRHDMAAIDHIVTVLRRLTHRYNTVSATLSELKSIGCASLTNPKSQL 118 Query: 264 LLLRIFWRAGMHAMLLQAY-HLMQSHGFVPNTFARNLLMDSLFRIGQPQLA--FSVFENT 94 +LLR++WRAGM+ M+++AY H+ ++GFVPNTFARNLLMD LFR G +A S+F +T Sbjct: 119 VLLRVYWRAGMYDMVVEAYEHMQSAYGFVPNTFARNLLMDVLFRTGHSHVAVSLSLFNHT 178 Query: 93 HPPNFFTFNIALLHLSN-------SNHLPYI 22 HPPNFFTFNIAL HLSN N LPYI Sbjct: 179 HPPNFFTFNIALFHLSNMNLKRQCHNTLPYI 209 >gb|KRG93487.1| hypothetical protein GLYMA_19G019400 [Glycine max] Length = 603 Score = 183 bits (464), Expect = 5e-44 Identities = 98/156 (62%), Positives = 119/156 (76%), Gaps = 11/156 (7%) Frame = -1 Query: 444 LIALSFFLWSAQRRRHGSLAVDHMLLVLARLTHRYKTLETILSHLESIGSRSLTNPNSFL 265 LIALS FLWSAQRRRH S A D ++ VL RLTHRY T+ ILSHLE+IG SLTNP S L Sbjct: 45 LIALSLFLWSAQRRRHDSFAFDRIVTVLLRLTHRYDTVPAILSHLETIGCASLTNPVSQL 104 Query: 264 LLLRIFWRAGMHAMLLQAYHLMQ-SHGFVPNTFARNLLMDSLFRIGQPQLA----FSVFE 100 +LLRI+ RAGM+AMLL+AYH +Q S+ FVP+TFARNL+MD+LFR+G LA S+F Sbjct: 105 VLLRIYSRAGMYAMLLEAYHHLQASYAFVPDTFARNLVMDALFRVGHSHLALTLTLSLFS 164 Query: 99 NTHPPNFFTFNIALLHLSNSN------HLPYILRLM 10 +THPPNFFTF+I LLHLS N +LP+I R++ Sbjct: 165 HTHPPNFFTFHILLLHLSKLNNNNLNLYLPHIARIL 200 >ref|XP_006603851.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830-like [Glycine max] Length = 599 Score = 183 bits (464), Expect = 5e-44 Identities = 98/156 (62%), Positives = 119/156 (76%), Gaps = 11/156 (7%) Frame = -1 Query: 444 LIALSFFLWSAQRRRHGSLAVDHMLLVLARLTHRYKTLETILSHLESIGSRSLTNPNSFL 265 LIALS FLWSAQRRRH S A D ++ VL RLTHRY T+ ILSHLE+IG SLTNP S L Sbjct: 45 LIALSLFLWSAQRRRHDSFAFDRIVTVLLRLTHRYDTVPAILSHLETIGCASLTNPVSQL 104 Query: 264 LLLRIFWRAGMHAMLLQAYHLMQ-SHGFVPNTFARNLLMDSLFRIGQPQLA----FSVFE 100 +LLRI+ RAGM+AMLL+AYH +Q S+ FVP+TFARNL+MD+LFR+G LA S+F Sbjct: 105 VLLRIYSRAGMYAMLLEAYHHLQASYAFVPDTFARNLVMDALFRVGHSHLALTLTLSLFS 164 Query: 99 NTHPPNFFTFNIALLHLSNSN------HLPYILRLM 10 +THPPNFFTF+I LLHLS N +LP+I R++ Sbjct: 165 HTHPPNFFTFHILLLHLSKLNNNNLNLYLPHIARIL 200 >ref|XP_006601680.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830-like [Glycine max] gi|947055865|gb|KRH05318.1| hypothetical protein GLYMA_17G219900 [Glycine max] Length = 643 Score = 181 bits (460), Expect = 1e-43 Identities = 99/160 (61%), Positives = 118/160 (73%), Gaps = 14/160 (8%) Frame = -1 Query: 444 LIALSFFLWSAQRRRHGSLAVDHMLLVLARLTHRYKTLETILSHLESIGSRSLTNPNSFL 265 LIA S FLWSAQRRRH S A D ++ VL RLTHRY T+ ILSHLE+IG SLTNP S L Sbjct: 45 LIAFSLFLWSAQRRRHDSFAFDRIVTVLRRLTHRYDTVPAILSHLETIGCASLTNPVSQL 104 Query: 264 LLLRIFWRAGMHAMLLQAYHLMQ-SHGFVPNTFARNLLMDSLFRIGQPQLA----FSVFE 100 +LLRI+ RAGM+AMLL+AYH +Q S+ FVP+TFARNL+MD+LFR+G LA S+F Sbjct: 105 VLLRIYSRAGMYAMLLEAYHHLQASYAFVPDTFARNLVMDALFRVGHSHLALTLTLSLFN 164 Query: 99 NTHPPNFFTFNIALLHLSNSN---------HLPYILRLML 7 +THPPNFFTF+I LLHLS N H+ +LRLML Sbjct: 165 HTHPPNFFTFHILLLHLSKLNNNNLNLNLPHIARMLRLML 204 >ref|XP_012567467.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Cicer arietinum] gi|828338123|ref|XP_012567468.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Cicer arietinum] gi|828338125|ref|XP_012567469.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Cicer arietinum] gi|828338128|ref|XP_012567470.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Cicer arietinum] gi|828338130|ref|XP_012567471.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Cicer arietinum] Length = 629 Score = 174 bits (441), Expect = 2e-41 Identities = 94/158 (59%), Positives = 119/158 (75%), Gaps = 10/158 (6%) Frame = -1 Query: 444 LIALSFFLWSAQRRRHGSLAVDHMLLVLARLTHRYKTLETILSHLESIGSRSLTN----- 280 LI LS FLWS++ R H SL +D ++ VL RLTHRYKT +TILS+L+SIGS + N Sbjct: 44 LITLSIFLWSSKHRCHYSLDLDRIVPVLHRLTHRYKTPQTILSNLQSIGSLNFPNTNTNR 103 Query: 279 -PNSFLLLLRIFWRAGMHAMLLQAYH-LMQSHGFVPNTFARNLLMDSLFRIGQPQLAFSV 106 PN+FLLLLRI RAG H ML+ +H ++QSHGFVP+TF+RNLLMDSLFR + Q+AFSV Sbjct: 104 NPNTFLLLLRIIHRAGDHIMLIDTFHHMVQSHGFVPDTFSRNLLMDSLFRTSRSQIAFSV 163 Query: 105 FENTHPPNFFTFNIALLHLSNSNH---LPYILRLMLRM 1 F++T PNFFTFNIA+ HLSN N+ + +LR MLR+ Sbjct: 164 FQHTSSPNFFTFNIAVFHLSNLNYFSDVVNVLRQMLRL 201 >ref|XP_012574783.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Cicer arietinum] gi|828332554|ref|XP_012574784.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Cicer arietinum] gi|828332556|ref|XP_012574785.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Cicer arietinum] gi|828332558|ref|XP_012574786.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Cicer arietinum] gi|828332560|ref|XP_012574787.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Cicer arietinum] Length = 636 Score = 167 bits (422), Expect = 4e-39 Identities = 91/155 (58%), Positives = 115/155 (74%), Gaps = 8/155 (5%) Frame = -1 Query: 444 LIALSFFLWSAQRRRHGSLAVDHMLLVLARLTHRYKTLETILSHLESIGS----RSLTNP 277 LI LS FLWS++ R H S D ++ VL RLT+RYKT +TILS+L+SIGS ++ NP Sbjct: 53 LITLSIFLWSSKHRHHHSPDFDRIIPVLHRLTYRYKTPQTILSNLKSIGSLNFPKNNINP 112 Query: 276 NSFLLLLRIFWRAGMHAMLLQAY-HLMQSHGFVPNTFARNLLMDSLFRIGQPQLAFSVFE 100 N FLL LRI RAG H ML+ + H++QSHGFVP+TFA NLLMDSLFR + Q+AFSVF+ Sbjct: 113 NPFLLFLRIIHRAGNHNMLIDTFDHMVQSHGFVPDTFACNLLMDSLFRTSRSQIAFSVFK 172 Query: 99 NTHPPNFFTFNIALLHLSNSNH---LPYILRLMLR 4 +T+ PNFFTFNIA+ HLSN N+ + +LR MLR Sbjct: 173 HTNSPNFFTFNIAIFHLSNLNYFTDVVNVLRQMLR 207 >gb|KHN34202.1| Putative pentatricopeptide repeat-containing protein [Glycine soja] Length = 502 Score = 149 bits (375), Expect = 1e-33 Identities = 82/136 (60%), Positives = 100/136 (73%), Gaps = 14/136 (10%) Frame = -1 Query: 372 LLVLARLTHRYKTLETILSHLESIGSRSLTNPNSFLLLLRIFWRAGMHAMLLQAYHLMQ- 196 + VL RLTHRY T+ ILSHLE+IG SLTNP S L+LLRI+ RAGM+AMLL+AYH +Q Sbjct: 1 MTVLLRLTHRYDTVPAILSHLETIGCASLTNPVSQLVLLRIYSRAGMYAMLLEAYHHLQA 60 Query: 195 SHGFVPNTFARNLLMDSLFRIGQPQLA----FSVFENTHPPNFFTFNIALLHLSNSN--- 37 S+ FVP+TFARNL+MD+LFR+G LA S+F +THPPNFFTF+I LLHLS N Sbjct: 61 SYAFVPDTFARNLVMDALFRVGHSHLALTLTLSLFSHTHPPNFFTFHILLLHLSKLNNNN 120 Query: 36 ------HLPYILRLML 7 H+ +LRLML Sbjct: 121 LNLNLPHIARMLRLML 136 >ref|XP_009379228.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] gi|694409173|ref|XP_009379229.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] gi|694409175|ref|XP_009379230.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] gi|694409178|ref|XP_009379231.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] gi|694409180|ref|XP_009379232.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] gi|694409183|ref|XP_009379233.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] gi|694409185|ref|XP_009379234.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] gi|694409187|ref|XP_009379236.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] gi|694409190|ref|XP_009379237.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] gi|694409192|ref|XP_009379238.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] gi|694409194|ref|XP_009379239.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] Length = 663 Score = 139 bits (350), Expect = 8e-31 Identities = 69/152 (45%), Positives = 103/152 (67%), Gaps = 5/152 (3%) Frame = -1 Query: 444 LIALSFFLWSAQRRR--HGSLAVDHMLLVLARLTHRYKTLETILSHLESIGSRSLTNPNS 271 LIAL FFLW A +R H + +DHM+ V+ R+ +Y+T++ I+ LES+G + + Sbjct: 75 LIALRFFLWCAGQRNYFHNKIVIDHMVGVIKRMMEQYRTVQLIIRELESMGC--VVKSQT 132 Query: 270 FLLLLRIFWRAGMHAMLLQAYHLMQSHGFVPNTFARNLLMDSLFRIGQPQLAFSVFENTH 91 FLLLLRI+WR ++ M+ +A+ LM ++GF+PNTFARN+++D+LF+IG LA + T Sbjct: 133 FLLLLRIYWRGELYTMVFEAFELMGTYGFIPNTFARNIIIDALFKIGHGDLAIKFLKETR 192 Query: 90 PPNFFTFNIALLHLSNSN---HLPYILRLMLR 4 PNF T+NIAL +L N H+ +LR+MLR Sbjct: 193 RPNFLTYNIALCNLCNLKDLCHIRDVLRMMLR 224 >ref|XP_008380383.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] gi|657976965|ref|XP_008380384.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] gi|657976967|ref|XP_008380385.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] gi|657976969|ref|XP_008380386.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] gi|657976971|ref|XP_008380387.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] gi|657976973|ref|XP_008380388.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] gi|657976975|ref|XP_008380390.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] gi|657976977|ref|XP_008380391.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] Length = 663 Score = 139 bits (350), Expect = 8e-31 Identities = 70/152 (46%), Positives = 103/152 (67%), Gaps = 5/152 (3%) Frame = -1 Query: 444 LIALSFFLWSAQRRR--HGSLAVDHMLLVLARLTHRYKTLETILSHLESIGSRSLTNPNS 271 LIAL FFLW A +R H + +DHM+ V+ R+ +Y+T++ I+ LES+G + + Sbjct: 75 LIALRFFLWCAGQRNYFHNKIVIDHMVGVIKRVMEQYRTVQLIIRELESMGC--VVKSQT 132 Query: 270 FLLLLRIFWRAGMHAMLLQAYHLMQSHGFVPNTFARNLLMDSLFRIGQPQLAFSVFENTH 91 FLLLLRI+WR M+ M+ +A+ LM ++GF+PNTFARN+++D+LF+IG LA + T Sbjct: 133 FLLLLRIYWRGEMYTMVFEAFELMGTYGFIPNTFARNIIIDALFKIGHGDLAIKFLKETR 192 Query: 90 PPNFFTFNIALLHLSNSN---HLPYILRLMLR 4 PNF T+NIAL +L N H+ +LR+MLR Sbjct: 193 RPNFLTYNIALCNLCNLKDLCHIRDMLRMMLR 224 >ref|XP_012066581.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Jatropha curcas] gi|802562843|ref|XP_012066582.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Jatropha curcas] gi|643736234|gb|KDP42609.1| hypothetical protein JCGZ_24383 [Jatropha curcas] Length = 662 Score = 137 bits (344), Expect = 4e-30 Identities = 74/152 (48%), Positives = 98/152 (64%), Gaps = 5/152 (3%) Frame = -1 Query: 444 LIALSFFLWSAQRRR--HGSLAVDHMLLVLARLTHRYKTLETILSHLESIGSRSLTNPNS 271 LIALSFF+W A++ H S D M+ V++RLT+RYKT+ETIL LES+G + + Sbjct: 104 LIALSFFIWCAKQHNYFHTSQTFDFMVSVVSRLTNRYKTVETILRELESVGL--IIKAQT 161 Query: 270 FLLLLRIFWRAGMHAMLLQAYHLMQSHGFVPNTFARNLLMDSLFRIGQPQLAFSVFENTH 91 FLLLLRI+WR GM +M+ + + M S GF PNTFARN++MD LF+ G + T Sbjct: 162 FLLLLRIYWRGGMFSMVFETFEKMGSFGFKPNTFARNVIMDVLFKSGHVDAGIKALKETE 221 Query: 90 PPNFFTFNIALLHLSNSNHL---PYILRLMLR 4 PNF +FNI L +L NHL ++LR MLR Sbjct: 222 FPNFLSFNITLTNLCKLNHLVNIKHVLRSMLR 253 >ref|XP_011659004.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Cucumis sativus] gi|778661916|ref|XP_011659009.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Cucumis sativus] gi|700210810|gb|KGN65906.1| hypothetical protein Csa_1G537540 [Cucumis sativus] Length = 665 Score = 135 bits (339), Expect = 2e-29 Identities = 73/153 (47%), Positives = 103/153 (67%), Gaps = 5/153 (3%) Frame = -1 Query: 444 LIALSFFLWSAQRRR--HGSLAVDHMLLVLARLTHRYKTLETILSHLESIGSRSLTNPNS 271 LIALSFF+W A++ H A D+M+ V++RL +Y+T+ IL LES+G+ +T + Sbjct: 76 LIALSFFMWCAKQPNFFHNPAAFDYMVGVVSRLMKQYETVNGILGGLESVGN--VTKAQT 133 Query: 270 FLLLLRIFWRAGMHAMLLQAYHLMQSHGFVPNTFARNLLMDSLFRIGQPQLAFSVFENTH 91 FLLLLRI+WR GM+ ++ +A+ M +GF PNTFARN++MD LF++G+ +A VF+ T Sbjct: 134 FLLLLRIYWRGGMYDLVFEAFDHMDRYGFTPNTFARNVIMDVLFKVGRADVALKVFKETL 193 Query: 90 PPNFFTFNIALLHLSNSNHLPYI---LRLMLRM 1 PNF TFNI L +LS + L I R MLRM Sbjct: 194 LPNFLTFNIVLCNLSKTKDLIGIGDTFRCMLRM 226 >ref|XP_008342596.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Malus domestica] gi|658014561|ref|XP_008342597.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Malus domestica] gi|658014563|ref|XP_008342599.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Malus domestica] gi|658014565|ref|XP_008342600.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Malus domestica] gi|658014567|ref|XP_008342601.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Malus domestica] gi|658014569|ref|XP_008342602.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Malus domestica] Length = 661 Score = 134 bits (338), Expect = 2e-29 Identities = 68/151 (45%), Positives = 99/151 (65%), Gaps = 5/151 (3%) Frame = -1 Query: 444 LIALSFFLWSAQRRR--HGSLAVDHMLLVLARLTHRYKTLETILSHLESIGSRSLTNPNS 271 LIAL FFLW A + H + +DHM+ V+ R+ +Y+T++ ++ LES+G + + Sbjct: 73 LIALRFFLWCAGQHNFFHSKIVIDHMVGVIKRVMEQYRTVKLVIRELESMGC--VVKSQT 130 Query: 270 FLLLLRIFWRAGMHAMLLQAYHLMQSHGFVPNTFARNLLMDSLFRIGQPQLAFSVFENTH 91 FLLLLRI+WR M+ M+ +A LM ++GF PNTFARN+++D+LF+IG LA + T Sbjct: 131 FLLLLRIYWRGEMYTMVFEAIELMGTYGFTPNTFARNIIIDALFKIGHVBLAIKFLKETR 190 Query: 90 PPNFFTFNIALLHLSNSN---HLPYILRLML 7 PNF TFNIAL +L N N H+ + R+ML Sbjct: 191 RPNFLTFNIALCNLCNINDLYHIGDVFRMML 221 >ref|XP_012460470.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Gossypium raimondii] gi|823255629|ref|XP_012460471.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Gossypium raimondii] gi|823255631|ref|XP_012460473.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Gossypium raimondii] gi|823255633|ref|XP_012460474.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Gossypium raimondii] gi|823255635|ref|XP_012460475.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Gossypium raimondii] gi|823255637|ref|XP_012460476.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Gossypium raimondii] gi|823255639|ref|XP_012460477.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Gossypium raimondii] gi|823255641|ref|XP_012460478.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Gossypium raimondii] gi|763807993|gb|KJB74895.1| hypothetical protein B456_012G013300 [Gossypium raimondii] Length = 653 Score = 132 bits (333), Expect = 8e-29 Identities = 70/153 (45%), Positives = 103/153 (67%), Gaps = 5/153 (3%) Frame = -1 Query: 444 LIALSFFLWSAQRRR--HGSLAVDHMLLVLARLTHRYKTLETILSHLESIGSRSLTNPNS 271 LIALSFFLW A++ H A D M+ V+++LT +Y T+ I+ LE+IG + P + Sbjct: 69 LIALSFFLWCAKQPNYFHDVQAFDCMVNVVSQLTKKYLTVRRIVGELENIGC--VIKPQT 126 Query: 270 FLLLLRIFWRAGMHAMLLQAYHLMQSHGFVPNTFARNLLMDSLFRIGQPQLAFSVFENTH 91 FLLLLRI+WR+ ++ M+ + +H M + GF PNTFARN++MD L+RIG A V +TH Sbjct: 127 FLLLLRIYWRSALYGMVFETFHEMAAFGFTPNTFARNVVMDVLYRIGHVDKAIKVLNDTH 186 Query: 90 PPNFFTFNIALLH---LSNSNHLPYILRLMLRM 1 PNF TFNIAL + LS+ +++ Y+ R M+++ Sbjct: 187 FPNFLTFNIALCNLCKLSDLSNISYVSRRMIQL 219 >ref|XP_008445574.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Cucumis melo] gi|659068664|ref|XP_008445582.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Cucumis melo] Length = 515 Score = 132 bits (333), Expect = 8e-29 Identities = 73/153 (47%), Positives = 101/153 (66%), Gaps = 5/153 (3%) Frame = -1 Query: 444 LIALSFFLWSAQRRR--HGSLAVDHMLLVLARLTHRYKTLETILSHLESIGSRSLTNPNS 271 LIALSFF+W A++ H A D+M+ V++RL +Y+T++ IL LES+G+ +T + Sbjct: 76 LIALSFFMWCAKQPNFFHNPAAFDYMVGVVSRLMKQYETVDGILGGLESVGN--VTKAQT 133 Query: 270 FLLLLRIFWRAGMHAMLLQAYHLMQSHGFVPNTFARNLLMDSLFRIGQPQLAFSVFENTH 91 FLLLLRI+WR GM ++ +A+ M GF PNTFARN++MD LF++G+ +A VF+ T Sbjct: 134 FLLLLRIYWRGGMFDLVFEAFDHMNHCGFTPNTFARNVIMDVLFKVGRADVALKVFKETQ 193 Query: 90 PPNFFTFNIALLHLSNSNHLPYI---LRLMLRM 1 PNF TFNI L +LS L I R MLRM Sbjct: 194 LPNFLTFNIVLCNLSKIKDLIGIGDAFRCMLRM 226 >ref|XP_003621961.1| PPR containing plant-like protein, putative [Medicago truncatula] gi|355496976|gb|AES78179.1| PPR containing plant-like protein, putative [Medicago truncatula] Length = 646 Score = 129 bits (325), Expect = 7e-28 Identities = 79/158 (50%), Positives = 104/158 (65%), Gaps = 10/158 (6%) Frame = -1 Query: 444 LIALSFFLWSAQRRRHGSLAVDHMLLVLARLTHRYKTLETILSHLESIGSRSLT----NP 277 LI L FL S+ + S A++ ML V AR+ H YKT +TILS L SIGS +L+ NP Sbjct: 19 LITLGSFLRSS---KPNSFAINQMLPVFARVIHHYKTHQTILSKLVSIGSINLSTININP 75 Query: 276 NSFLLLLRIFWRAGMHAMLLQAY-HLMQSHGFV--PNTFARNLLMDSLFRIGQPQLAFSV 106 N F+ LLRIF R+G H +L++ ++++ HGF TFA NLLM+SLF+ QP+ AF + Sbjct: 76 NPFINLLRIFSRSGNHELLIKTCDYMVEFHGFQISSKTFASNLLMESLFKASQPKNAFKI 135 Query: 105 FENTHPPNFFTFNIALLHLSNSN---HLPYILRLMLRM 1 F T PNF TFNIAL HLSN N ++ Y+LR MLR+ Sbjct: 136 FGETRSPNFLTFNIALFHLSNFNDIVNVKYVLREMLRL 173 >ref|XP_008227981.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Prunus mume] Length = 663 Score = 128 bits (322), Expect = 1e-27 Identities = 67/152 (44%), Positives = 97/152 (63%), Gaps = 5/152 (3%) Frame = -1 Query: 444 LIALSFFLWSAQRRR--HGSLAVDHMLLVLARLTHRYKTLETILSHLESIGSRSLTNPNS 271 LIAL FFLW AQ+ H + DHM+ V+ R+ RYKT+++++ L ++G + + Sbjct: 75 LIALRFFLWCAQQPNFFHNRIVFDHMVGVIKRVMERYKTVKSVVRELATVGC--VIKSQT 132 Query: 270 FLLLLRIFWRAGMHAMLLQAYHLMQSHGFVPNTFARNLLMDSLFRIGQPQLAFSVFENTH 91 FLLLLRI+WR M+ M+ +A M ++GF PNTF RN+++D F+IG+ LAF + T Sbjct: 133 FLLLLRIYWRGRMYEMVFEAIEQMGAYGFTPNTFVRNVIIDVSFKIGRGDLAFKSLKETQ 192 Query: 90 PPNFFTFNIALLHLSNSN---HLPYILRLMLR 4 PNF TFNI L +L N H+ +LR+MLR Sbjct: 193 VPNFLTFNITLCNLCKFNDLFHIGDVLRMMLR 224 >ref|XP_007217131.1| hypothetical protein PRUPE_ppa015612m2g, partial [Prunus persica] gi|462413281|gb|EMJ18330.1| hypothetical protein PRUPE_ppa015612m2g, partial [Prunus persica] Length = 261 Score = 127 bits (318), Expect = 4e-27 Identities = 67/152 (44%), Positives = 96/152 (63%), Gaps = 5/152 (3%) Frame = -1 Query: 444 LIALSFFLWSAQRRR--HGSLAVDHMLLVLARLTHRYKTLETILSHLESIGSRSLTNPNS 271 LIAL FFLW AQ+ H + DHM+ V+ R+ RYKT+++++ L S+G + + Sbjct: 51 LIALRFFLWCAQQPNFFHNRIVFDHMVGVIKRMMERYKTVKSVVRELASVGC--VIKSQT 108 Query: 270 FLLLLRIFWRAGMHAMLLQAYHLMQSHGFVPNTFARNLLMDSLFRIGQPQLAFSVFENTH 91 FLLLLRI+WR M+ M+ +A M ++GF PNTF RN+++D F+IG+ LA + T Sbjct: 109 FLLLLRIYWRGRMYEMVFEAIEQMGAYGFTPNTFVRNVIIDVSFKIGRGDLAIKSLKETQ 168 Query: 90 PPNFFTFNIALLHLSNSN---HLPYILRLMLR 4 PNF TFNI L +L N H+ +LR+MLR Sbjct: 169 VPNFVTFNIMLCNLCKFNDLFHIGDVLRMMLR 200 >ref|XP_007011398.1| Pentatricopeptide repeat superfamily protein, putative isoform 2 [Theobroma cacao] gi|508728311|gb|EOY20208.1| Pentatricopeptide repeat superfamily protein, putative isoform 2 [Theobroma cacao] Length = 657 Score = 126 bits (316), Expect = 7e-27 Identities = 67/152 (44%), Positives = 98/152 (64%), Gaps = 5/152 (3%) Frame = -1 Query: 444 LIALSFFLWSAQRRR--HGSLAVDHMLLVLARLTHRYKTLETILSHLESIGSRSLTNPNS 271 LIAL FFLW A++ H A D M+ VL +LT +Y T+ +I+ LE++G + P + Sbjct: 69 LIALGFFLWCAKQPNYFHDGEAFDCMVNVLTQLTKKYVTVRSIVGELETVGC--VIKPQT 126 Query: 270 FLLLLRIFWRAGMHAMLLQAYHLMQSHGFVPNTFARNLLMDSLFRIGQPQLAFSVFENTH 91 FLLLLRI+WR G++ M+ + + M + GF PNTFARN++MD LF+IG +A V + T Sbjct: 127 FLLLLRIYWRGGLYGMVFETFEEMATVGFTPNTFARNVIMDVLFKIGHVDVAIKVLKETG 186 Query: 90 PPNFFTFNIALLH---LSNSNHLPYILRLMLR 4 PNF TFN AL + L + +++ Y++R M R Sbjct: 187 FPNFLTFNTALCNLCKLRDLSNMKYVIRRMFR 218 >ref|XP_007011397.1| Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|508728310|gb|EOY20207.1| Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] Length = 695 Score = 126 bits (316), Expect = 7e-27 Identities = 67/152 (44%), Positives = 98/152 (64%), Gaps = 5/152 (3%) Frame = -1 Query: 444 LIALSFFLWSAQRRR--HGSLAVDHMLLVLARLTHRYKTLETILSHLESIGSRSLTNPNS 271 LIAL FFLW A++ H A D M+ VL +LT +Y T+ +I+ LE++G + P + Sbjct: 107 LIALGFFLWCAKQPNYFHDGEAFDCMVNVLTQLTKKYVTVRSIVGELETVGC--VIKPQT 164 Query: 270 FLLLLRIFWRAGMHAMLLQAYHLMQSHGFVPNTFARNLLMDSLFRIGQPQLAFSVFENTH 91 FLLLLRI+WR G++ M+ + + M + GF PNTFARN++MD LF+IG +A V + T Sbjct: 165 FLLLLRIYWRGGLYGMVFETFEEMATVGFTPNTFARNVIMDVLFKIGHVDVAIKVLKETG 224 Query: 90 PPNFFTFNIALLH---LSNSNHLPYILRLMLR 4 PNF TFN AL + L + +++ Y++R M R Sbjct: 225 FPNFLTFNTALCNLCKLRDLSNMKYVIRRMFR 256