BLASTX nr result
ID: Wisteria21_contig00037321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00037321 (327 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003531496.1| PREDICTED: LOB domain-containing protein 4-l... 64 6e-08 gb|KHN26845.1| LOB domain-containing protein 4 [Glycine soja] 62 1e-07 ref|NP_001241363.1| uncharacterized protein LOC100790989 [Glycin... 62 1e-07 >ref|XP_003531496.1| PREDICTED: LOB domain-containing protein 4-like [Glycine max] gi|947095162|gb|KRH43747.1| hypothetical protein GLYMA_08G169000 [Glycine max] Length = 177 Score = 63.5 bits (153), Expect = 6e-08 Identities = 34/49 (69%), Positives = 38/49 (77%), Gaps = 6/49 (12%) Frame = -2 Query: 323 QPS-MPPNTTASNENLYHSS-----QTKSLFGTDTVVDQANMGQSLWSY 195 QPS +P + +S+ENLYHSS QTKSLFG D VVDQANMGQSLWSY Sbjct: 129 QPSVLPEASNSSSENLYHSSRLLSSQTKSLFGMDMVVDQANMGQSLWSY 177 >gb|KHN26845.1| LOB domain-containing protein 4 [Glycine soja] Length = 105 Score = 62.4 bits (150), Expect = 1e-07 Identities = 33/49 (67%), Positives = 38/49 (77%), Gaps = 6/49 (12%) Frame = -2 Query: 323 QPS-MPPNTTASNENLYHSS-----QTKSLFGTDTVVDQANMGQSLWSY 195 QPS +P + +S+ENLYHSS QTKS+FG D VVDQANMGQSLWSY Sbjct: 57 QPSVLPEASNSSSENLYHSSRLLSSQTKSVFGMDMVVDQANMGQSLWSY 105 >ref|NP_001241363.1| uncharacterized protein LOC100790989 [Glycine max] gi|255645217|gb|ACU23106.1| unknown [Glycine max] gi|734438065|gb|KHN48908.1| LOB domain-containing protein 4 [Glycine soja] gi|947064445|gb|KRH13706.1| hypothetical protein GLYMA_15G258100 [Glycine max] Length = 178 Score = 62.4 bits (150), Expect = 1e-07 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 6/49 (12%) Frame = -2 Query: 323 QPS-MPPNTTASNENLYHSS-----QTKSLFGTDTVVDQANMGQSLWSY 195 QPS +P + AS+ENLYHSS QTKSLF D VVDQANMGQSLWSY Sbjct: 130 QPSVLPEASNASSENLYHSSRLLSSQTKSLFSMDMVVDQANMGQSLWSY 178