BLASTX nr result
ID: Wisteria21_contig00037296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00037296 (410 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003608234.1| cysteine-rich TM module stress tolerance pro... 56 9e-06 >ref|XP_003608234.1| cysteine-rich TM module stress tolerance protein [Medicago truncatula] gi|87240733|gb|ABD32591.1| conserved hypothetical protein [Medicago truncatula] gi|355509289|gb|AES90431.1| cysteine-rich TM module stress tolerance protein [Medicago truncatula] gi|388494888|gb|AFK35510.1| unknown [Medicago truncatula] Length = 80 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/46 (58%), Positives = 33/46 (71%), Gaps = 1/46 (2%) Frame = -3 Query: 138 IAYPPTVIAYSSPSKANPQTSYVSAPPPMGYPTKDG-AGYPQQSVP 4 ++YPP AYS+P YV+APPPMGYP+KDG AGYPQQ +P Sbjct: 14 VSYPPPGEAYSTPQ-------YVTAPPPMGYPSKDGSAGYPQQRIP 52