BLASTX nr result
ID: Wisteria21_contig00037275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00037275 (288 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004514999.1| PREDICTED: putative disease resistance prote... 47 1e-10 ref|XP_003598563.1| NBS-LRR type disease resistance protein [Med... 47 9e-08 ref|XP_003598562.2| NBS-LRR type disease resistance protein [Med... 49 5e-07 ref|XP_013458979.1| NBS-LRR type disease resistance protein [Med... 49 6e-07 ref|XP_003598547.1| NBS-LRR type disease resistance protein [Med... 48 7e-07 ref|XP_003606009.1| NBS-LRR type disease resistance protein, par... 47 2e-06 >ref|XP_004514999.1| PREDICTED: putative disease resistance protein RGA4 [Cicer arietinum] gi|502171157|ref|XP_004515000.1| PREDICTED: putative disease resistance protein RGA4 [Cicer arietinum] Length = 848 Score = 47.4 bits (111), Expect(2) = 1e-10 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 4/42 (9%) Frame = +1 Query: 175 MEVRWGV*L----WPFPSKVDKQENKT*LEDEMILQGLQPHH 288 +E+RW + W P+K +++NK LEDEMILQGLQPHH Sbjct: 712 LELRWAYYVDFHPWSLPAKRAEEDNKNWLEDEMILQGLQPHH 753 Score = 45.1 bits (105), Expect(2) = 1e-10 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = +2 Query: 80 MRWLHFLRNNAAEVEFAKVLLVKRHLQQLKL*W 178 ++ L FLRN AE+E AKVLL KRHLQQL+L W Sbjct: 684 IKGLDFLRNKNAEIESAKVLLEKRHLQQLELRW 716 >ref|XP_003598563.1| NBS-LRR type disease resistance protein [Medicago truncatula] gi|355487611|gb|AES68814.1| NBS-LRR type disease resistance protein [Medicago truncatula] Length = 852 Score = 46.6 bits (109), Expect(2) = 9e-08 Identities = 25/42 (59%), Positives = 29/42 (69%), Gaps = 2/42 (4%) Frame = +2 Query: 89 LHFLRNNAAEVEFAKVLLVKRHLQQLKL*WR*DGEF--DYGH 208 L FLRN AAE+EF KVLL K HLQ L+L W D +F D+ H Sbjct: 687 LDFLRNAAAEIEFVKVLLEKEHLQLLELRWTYDEDFIEDFRH 728 Score = 36.2 bits (82), Expect(2) = 9e-08 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +1 Query: 229 QENKT*LEDEMILQGLQPHH 288 QENK LEDE IL+GLQPHH Sbjct: 738 QENKHRLEDEKILEGLQPHH 757 >ref|XP_003598562.2| NBS-LRR type disease resistance protein [Medicago truncatula] gi|657391922|gb|AES68813.2| NBS-LRR type disease resistance protein [Medicago truncatula] Length = 897 Score = 48.9 bits (115), Expect(2) = 5e-07 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +2 Query: 80 MRWLHFLRNNAAEVEFAKVLLVKRHLQQLKL*W 178 ++ L FLRNNAAE+E AKVL+ KRHLQQL+L W Sbjct: 722 LKGLKFLRNNAAEIESAKVLVEKRHLQQLELRW 754 Score = 31.2 bits (69), Expect(2) = 5e-07 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = +1 Query: 247 LEDEMILQGLQPHH 288 +EDE+ILQGLQPHH Sbjct: 783 VEDEIILQGLQPHH 796 >ref|XP_013458979.1| NBS-LRR type disease resistance protein [Medicago truncatula] gi|657391923|gb|KEH33021.1| NBS-LRR type disease resistance protein [Medicago truncatula] Length = 860 Score = 48.9 bits (115), Expect(2) = 6e-07 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +2 Query: 80 MRWLHFLRNNAAEVEFAKVLLVKRHLQQLKL*W 178 ++ L FLRNNAAE+E AKVL+ KRHLQQL+L W Sbjct: 685 LKGLKFLRNNAAEIESAKVLVEKRHLQQLELRW 717 Score = 31.2 bits (69), Expect(2) = 6e-07 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = +1 Query: 247 LEDEMILQGLQPHH 288 +EDE+ILQGLQPHH Sbjct: 746 VEDEIILQGLQPHH 759 >ref|XP_003598547.1| NBS-LRR type disease resistance protein [Medicago truncatula] gi|355487595|gb|AES68798.1| NBS-LRR type disease resistance protein [Medicago truncatula] Length = 799 Score = 47.8 bits (112), Expect(2) = 7e-07 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +2 Query: 80 MRWLHFLRNNAAEVEFAKVLLVKRHLQQLKL*W 178 ++ L+FLRNNAAE+E AKVL+ KRHLQ L+L W Sbjct: 685 LKGLNFLRNNAAEIESAKVLVEKRHLQHLELRW 717 Score = 32.0 bits (71), Expect(2) = 7e-07 Identities = 18/38 (47%), Positives = 23/38 (60%) Frame = +1 Query: 175 MEVRWGV*LWPFPSKVDKQENKT*LEDEMILQGLQPHH 288 +E+RW + VD+ E EDE+ILQGLQPHH Sbjct: 713 LELRW--------NHVDQNEIME--EDEIILQGLQPHH 740 >ref|XP_003606009.1| NBS-LRR type disease resistance protein, partial [Medicago truncatula] gi|355507064|gb|AES88206.1| NBS-LRR type disease resistance protein, partial [Medicago truncatula] Length = 806 Score = 47.4 bits (111), Expect(2) = 2e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +2 Query: 80 MRWLHFLRNNAAEVEFAKVLLVKRHLQQLKL*W 178 ++ L+FLRNNA ++E AKVLL KRHLQQL+L W Sbjct: 685 LKGLNFLRNNAEKIESAKVLLEKRHLQQLELRW 717 Score = 31.2 bits (69), Expect(2) = 2e-06 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +1 Query: 175 MEVRWG-V*LWPFPSKVDKQENKT*LEDEMILQGLQPHH 288 +E+RW V PF + NK +EDE+I GLQPHH Sbjct: 713 LELRWNHVDEDPFEDDLSSP-NKNLVEDEIIFLGLQPHH 750