BLASTX nr result
ID: Wisteria21_contig00037273
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00037273 (334 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012567456.1| PREDICTED: probable leucine-rich repeat rece... 60 6e-07 ref|XP_012567455.1| PREDICTED: probable leucine-rich repeat rece... 60 6e-07 ref|XP_012567454.1| PREDICTED: probable leucine-rich repeat rece... 60 6e-07 >ref|XP_012567456.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 isoform X3 [Cicer arietinum] Length = 966 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = +2 Query: 2 QYYQQRKENSIIEGQSQSIPTDESYALISNTDSSYWENRN 121 QYYQQR ENSI E QSQSIPTDES A + +TDSS WE RN Sbjct: 927 QYYQQRGENSISEVQSQSIPTDESRAFMYDTDSSCWEPRN 966 >ref|XP_012567455.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 isoform X2 [Cicer arietinum] Length = 976 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = +2 Query: 2 QYYQQRKENSIIEGQSQSIPTDESYALISNTDSSYWENRN 121 QYYQQR ENSI E QSQSIPTDES A + +TDSS WE RN Sbjct: 937 QYYQQRGENSISEVQSQSIPTDESRAFMYDTDSSCWEPRN 976 >ref|XP_012567454.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 isoform X1 [Cicer arietinum] Length = 1000 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = +2 Query: 2 QYYQQRKENSIIEGQSQSIPTDESYALISNTDSSYWENRN 121 QYYQQR ENSI E QSQSIPTDES A + +TDSS WE RN Sbjct: 961 QYYQQRGENSISEVQSQSIPTDESRAFMYDTDSSCWEPRN 1000