BLASTX nr result
ID: Wisteria21_contig00037231
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00037231 (360 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003625000.1| VQ motif protein [Medicago truncatula] gi|35... 63 1e-07 ref|XP_004493402.1| PREDICTED: sigma factor binding protein 1, c... 60 8e-07 ref|XP_010276684.1| PREDICTED: sigma factor binding protein 1, c... 59 1e-06 emb|CDP09565.1| unnamed protein product [Coffea canephora] 59 2e-06 ref|XP_014489737.1| PREDICTED: sigma factor binding protein 2, c... 58 2e-06 gb|KOM38724.1| hypothetical protein LR48_Vigan03g210600 [Vigna a... 58 2e-06 ref|XP_010089743.1| hypothetical protein L484_013937 [Morus nota... 58 2e-06 gb|KHN08877.1| hypothetical protein glysoja_029454 [Glycine soja] 58 2e-06 ref|XP_006576783.1| PREDICTED: sigma factor binding protein 1, c... 58 2e-06 ref|XP_007162094.1| hypothetical protein PHAVU_001G123400g [Phas... 58 2e-06 ref|XP_003554126.1| PREDICTED: uncharacterized protein LOC100808... 58 2e-06 ref|XP_010245501.1| PREDICTED: sigma factor binding protein 1, c... 58 3e-06 ref|XP_007028444.1| VQ motif-containing protein, putative [Theob... 57 4e-06 >ref|XP_003625000.1| VQ motif protein [Medicago truncatula] gi|355500015|gb|AES81218.1| VQ motif protein [Medicago truncatula] Length = 165 Score = 62.8 bits (151), Expect = 1e-07 Identities = 37/63 (58%), Positives = 43/63 (68%), Gaps = 4/63 (6%) Frame = -2 Query: 179 TTTNNSVISSVQQXXXXXXXXXXXXXXXKD----PIKVVYISNPMKVKTSASEFRALVQE 12 ++T++SVIS+VQQ + PIKVVYISNPMKVKTSASEFRALVQE Sbjct: 7 SSTSSSVISTVQQKTPTKLTKPKKKKNNNNTYNKPIKVVYISNPMKVKTSASEFRALVQE 66 Query: 11 LTG 3 LTG Sbjct: 67 LTG 69 >ref|XP_004493402.1| PREDICTED: sigma factor binding protein 1, chloroplastic [Cicer arietinum] Length = 156 Score = 59.7 bits (143), Expect = 8e-07 Identities = 35/62 (56%), Positives = 40/62 (64%), Gaps = 4/62 (6%) Frame = -2 Query: 176 TTNNSVISSVQQXXXXXXXXXXXXXXXKD----PIKVVYISNPMKVKTSASEFRALVQEL 9 T N+S I+++QQ + PIKVVYISNPMKVKTSASEFRALVQEL Sbjct: 3 TINSSTITTMQQIKTPPTKITKPNKKKNNNNKNPIKVVYISNPMKVKTSASEFRALVQEL 62 Query: 8 TG 3 TG Sbjct: 63 TG 64 >ref|XP_010276684.1| PREDICTED: sigma factor binding protein 1, chloroplastic-like [Nelumbo nucifera] Length = 142 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -2 Query: 89 PIKVVYISNPMKVKTSASEFRALVQELTG 3 PIKVVYISNPMKVKTSASEFRALVQELTG Sbjct: 21 PIKVVYISNPMKVKTSASEFRALVQELTG 49 >emb|CDP09565.1| unnamed protein product [Coffea canephora] Length = 148 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -2 Query: 89 PIKVVYISNPMKVKTSASEFRALVQELTG 3 P+KVVYISNPMKVKTSASEFRALVQELTG Sbjct: 22 PVKVVYISNPMKVKTSASEFRALVQELTG 50 >ref|XP_014489737.1| PREDICTED: sigma factor binding protein 2, chloroplastic [Vigna radiata var. radiata] Length = 145 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 89 PIKVVYISNPMKVKTSASEFRALVQELTG 3 P+KVVYISNPMK+KTSASEFRALVQELTG Sbjct: 29 PVKVVYISNPMKIKTSASEFRALVQELTG 57 >gb|KOM38724.1| hypothetical protein LR48_Vigan03g210600 [Vigna angularis] Length = 148 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 89 PIKVVYISNPMKVKTSASEFRALVQELTG 3 P+KVVYISNPMK+KTSASEFRALVQELTG Sbjct: 29 PVKVVYISNPMKIKTSASEFRALVQELTG 57 >ref|XP_010089743.1| hypothetical protein L484_013937 [Morus notabilis] gi|587848001|gb|EXB38304.1| hypothetical protein L484_013937 [Morus notabilis] Length = 161 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 89 PIKVVYISNPMKVKTSASEFRALVQELTG 3 P+KVVYISNPMK+KTSASEFRALVQELTG Sbjct: 30 PVKVVYISNPMKIKTSASEFRALVQELTG 58 >gb|KHN08877.1| hypothetical protein glysoja_029454 [Glycine soja] Length = 171 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 89 PIKVVYISNPMKVKTSASEFRALVQELTG 3 P+KVVYISNPMK+KTSASEFRALVQELTG Sbjct: 31 PVKVVYISNPMKIKTSASEFRALVQELTG 59 >ref|XP_006576783.1| PREDICTED: sigma factor binding protein 1, chloroplastic-like [Glycine max] gi|734397923|gb|KHN30364.1| hypothetical protein glysoja_025855 [Glycine soja] gi|947118524|gb|KRH66773.1| hypothetical protein GLYMA_03G127800 [Glycine max] Length = 167 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 89 PIKVVYISNPMKVKTSASEFRALVQELTG 3 P+KVVYISNPMK+KTSASEFRALVQELTG Sbjct: 31 PVKVVYISNPMKIKTSASEFRALVQELTG 59 >ref|XP_007162094.1| hypothetical protein PHAVU_001G123400g [Phaseolus vulgaris] gi|561035558|gb|ESW34088.1| hypothetical protein PHAVU_001G123400g [Phaseolus vulgaris] Length = 149 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 89 PIKVVYISNPMKVKTSASEFRALVQELTG 3 P+KVVYISNPMK+KTSASEFRALVQELTG Sbjct: 29 PVKVVYISNPMKIKTSASEFRALVQELTG 57 >ref|XP_003554126.1| PREDICTED: uncharacterized protein LOC100808231 [Glycine max] gi|947045476|gb|KRG95105.1| hypothetical protein GLYMA_19G130400 [Glycine max] Length = 168 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 89 PIKVVYISNPMKVKTSASEFRALVQELTG 3 P+KVVYISNPMK+KTSASEFRALVQELTG Sbjct: 31 PVKVVYISNPMKIKTSASEFRALVQELTG 59 >ref|XP_010245501.1| PREDICTED: sigma factor binding protein 1, chloroplastic-like [Nelumbo nucifera] Length = 145 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -2 Query: 89 PIKVVYISNPMKVKTSASEFRALVQELTG 3 PIKVVYISNPMKVKTSAS+FRALVQELTG Sbjct: 21 PIKVVYISNPMKVKTSASQFRALVQELTG 49 >ref|XP_007028444.1| VQ motif-containing protein, putative [Theobroma cacao] gi|508717049|gb|EOY08946.1| VQ motif-containing protein, putative [Theobroma cacao] Length = 154 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -2 Query: 89 PIKVVYISNPMKVKTSASEFRALVQELTG 3 PIKVVYISNPMKVKTSAS+FRALVQELTG Sbjct: 28 PIKVVYISNPMKVKTSASKFRALVQELTG 56