BLASTX nr result
ID: Wisteria21_contig00037116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00037116 (268 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004515635.1| PREDICTED: pentatricopeptide repeat-containi... 63 8e-08 ref|XP_007131288.1| hypothetical protein PHAVU_011G001300g [Phas... 57 4e-06 >ref|XP_004515635.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360 [Cicer arietinum] Length = 477 Score = 63.2 bits (152), Expect = 8e-08 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = +2 Query: 131 MPHFVNFQFFSCLHRLKTLPFSTQQMGGMASVADTLYSHLHKSNG 265 M HF+ +FFS H LK +PFSTQQM G AS+ADTLY+HLH++NG Sbjct: 1 MAHFLKIRFFSSSHTLKMVPFSTQQM-GFASIADTLYTHLHENNG 44 >ref|XP_007131288.1| hypothetical protein PHAVU_011G001300g [Phaseolus vulgaris] gi|561004288|gb|ESW03282.1| hypothetical protein PHAVU_011G001300g [Phaseolus vulgaris] Length = 474 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = +2 Query: 131 MPHFVNFQFFSCLHRLKTLPFSTQQMGGMASVADTLYSHLHKSNG 265 MP FVNF+ F H LKTLPFST +MG +ADTL +HLH+SNG Sbjct: 1 MPQFVNFRLFPRFHALKTLPFSTHRMG----MADTLCTHLHQSNG 41