BLASTX nr result
ID: Wisteria21_contig00037112
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00037112 (234 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRG96121.1| hypothetical protein GLYMA_19G190700 [Glycine max] 59 1e-06 ref|XP_006604616.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 gb|KRH67836.1| hypothetical protein GLYMA_03G190300 [Glycine max] 59 2e-06 ref|XP_003520679.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 >gb|KRG96121.1| hypothetical protein GLYMA_19G190700 [Glycine max] Length = 782 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 172 FFCSQSLTLCEAHPQEQQRLQTVQMLQTSLDQGRINTVQRFLK 44 FFCSQSLTLCE+ PQ Q RLQ VQ L+T L++GR T +RFL+ Sbjct: 44 FFCSQSLTLCESDPQYQNRLQKVQKLETLLNRGRTVTARRFLR 86 >ref|XP_006604616.1| PREDICTED: pentatricopeptide repeat-containing protein At5g12100, mitochondrial-like [Glycine max] Length = 409 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 172 FFCSQSLTLCEAHPQEQQRLQTVQMLQTSLDQGRINTVQRFLK 44 FFCSQSLTLCE+ PQ Q RLQ VQ L+T L++GR T +RFL+ Sbjct: 44 FFCSQSLTLCESDPQYQNRLQKVQKLETLLNRGRTVTARRFLR 86 >gb|KRH67836.1| hypothetical protein GLYMA_03G190300 [Glycine max] Length = 677 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = -3 Query: 172 FFCSQSLTLCEAHPQEQQRLQTVQMLQTSLDQGRINTVQRFLK 44 FFCSQSLTLCE+ PQ Q+RLQ VQ L+T + +GR T +RFL+ Sbjct: 23 FFCSQSLTLCESDPQYQKRLQKVQKLETLISRGRTITARRFLR 65 >ref|XP_003520679.1| PREDICTED: pentatricopeptide repeat-containing protein At5g12100, mitochondrial-like isoform X1 [Glycine max] gi|571446303|ref|XP_006577051.1| PREDICTED: pentatricopeptide repeat-containing protein At5g12100, mitochondrial-like isoform X2 [Glycine max] gi|947119585|gb|KRH67834.1| hypothetical protein GLYMA_03G190300 [Glycine max] gi|947119586|gb|KRH67835.1| hypothetical protein GLYMA_03G190300 [Glycine max] Length = 777 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = -3 Query: 172 FFCSQSLTLCEAHPQEQQRLQTVQMLQTSLDQGRINTVQRFLK 44 FFCSQSLTLCE+ PQ Q+RLQ VQ L+T + +GR T +RFL+ Sbjct: 23 FFCSQSLTLCESDPQYQKRLQKVQKLETLISRGRTITARRFLR 65