BLASTX nr result
ID: Wisteria21_contig00036918
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00036918 (280 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007155895.1| hypothetical protein PHAVU_003G241000g [Phas... 61 4e-07 >ref|XP_007155895.1| hypothetical protein PHAVU_003G241000g [Phaseolus vulgaris] gi|561029249|gb|ESW27889.1| hypothetical protein PHAVU_003G241000g [Phaseolus vulgaris] Length = 79 Score = 60.8 bits (146), Expect = 4e-07 Identities = 30/38 (78%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = -3 Query: 113 VALKRE-VGWSGMALVGKPMAKSKWVGVELIRSSTEKG 3 +ALKRE VGW GM LVGKPM KSKWVGVELI S+EKG Sbjct: 32 IALKREEVGWCGMGLVGKPMGKSKWVGVELISYSSEKG 69