BLASTX nr result
ID: Wisteria21_contig00036870
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00036870 (240 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004490688.1| PREDICTED: putative tRNA pseudouridine synth... 152 1e-34 gb|KHN08840.1| Putative tRNA pseudouridine synthase [Glycine soja] 151 2e-34 ref|XP_003557058.1| PREDICTED: putative tRNA pseudouridine synth... 151 2e-34 ref|XP_007142072.1| hypothetical protein PHAVU_008G250200g [Phas... 149 6e-34 gb|KRH72778.1| hypothetical protein GLYMA_02G233500 [Glycine max] 149 8e-34 gb|KHN46103.1| Putative tRNA pseudouridine synthase [Glycine soja] 149 8e-34 ref|XP_003518334.1| PREDICTED: putative tRNA pseudouridine synth... 149 8e-34 ref|XP_014503538.1| PREDICTED: putative tRNA pseudouridine synth... 148 1e-33 ref|XP_003615969.1| tRNA pseudouridine synthase [Medicago trunca... 144 3e-32 ref|XP_010106701.1| Putative tRNA pseudouridine synthase [Morus ... 126 7e-27 ref|XP_007207376.1| hypothetical protein PRUPE_ppa004352mg [Prun... 124 2e-26 ref|XP_008384725.1| PREDICTED: putative tRNA pseudouridine synth... 124 4e-26 gb|KHN46102.1| Putative tRNA pseudouridine synthase [Glycine soja] 123 6e-26 ref|XP_006575439.1| PREDICTED: putative tRNA pseudouridine synth... 123 6e-26 ref|XP_006575435.1| PREDICTED: putative tRNA pseudouridine synth... 123 6e-26 ref|XP_007017040.1| Pseudouridine synthase family protein [Theob... 122 1e-25 ref|XP_009369541.1| PREDICTED: putative tRNA pseudouridine synth... 122 1e-25 ref|XP_012078415.1| PREDICTED: putative tRNA pseudouridine synth... 121 2e-25 ref|XP_012078395.1| PREDICTED: putative tRNA pseudouridine synth... 121 2e-25 gb|KJB20490.1| hypothetical protein B456_003G151400 [Gossypium r... 121 2e-25 >ref|XP_004490688.1| PREDICTED: putative tRNA pseudouridine synthase [Cicer arietinum] Length = 483 Score = 152 bits (383), Expect = 1e-34 Identities = 71/79 (89%), Positives = 75/79 (94%) Frame = -2 Query: 239 FDPRRECNLRKYSYLLPADIIGIQSHFSEDEIDFHISEFNSILSVFEGEHPFHNYTVRSK 60 FDPRRECNLRKYSYLLPADIIGIQSHFSEDEIDFHISEFNSIL VFEG+HPFHNYTVRS Sbjct: 167 FDPRRECNLRKYSYLLPADIIGIQSHFSEDEIDFHISEFNSILGVFEGDHPFHNYTVRSI 226 Query: 59 YRKKYHARQSLGNGGLSDR 3 YRKK HAR+S GNGG+S+R Sbjct: 227 YRKKNHARKSPGNGGMSNR 245 >gb|KHN08840.1| Putative tRNA pseudouridine synthase [Glycine soja] Length = 519 Score = 151 bits (381), Expect = 2e-34 Identities = 70/79 (88%), Positives = 73/79 (92%) Frame = -2 Query: 239 FDPRRECNLRKYSYLLPADIIGIQSHFSEDEIDFHISEFNSILSVFEGEHPFHNYTVRSK 60 FDPRRECNLRKYSYLLPADIIGIQSHFS+DEIDFHI EFNSIL+VFEGEHPFHNYTVRSK Sbjct: 191 FDPRRECNLRKYSYLLPADIIGIQSHFSQDEIDFHILEFNSILNVFEGEHPFHNYTVRSK 250 Query: 59 YRKKYHARQSLGNGGLSDR 3 YRKKY RQS GN G+ DR Sbjct: 251 YRKKYQVRQSSGNDGMPDR 269 >ref|XP_003557058.1| PREDICTED: putative tRNA pseudouridine synthase-like [Glycine max] gi|947037805|gb|KRG88463.1| hypothetical protein GLYMA_U039500 [Glycine max] Length = 518 Score = 151 bits (381), Expect = 2e-34 Identities = 70/79 (88%), Positives = 73/79 (92%) Frame = -2 Query: 239 FDPRRECNLRKYSYLLPADIIGIQSHFSEDEIDFHISEFNSILSVFEGEHPFHNYTVRSK 60 FDPRRECNLRKYSYLLPADIIGIQSHFS+DEIDFHI EFNSIL+VFEGEHPFHNYTVRSK Sbjct: 190 FDPRRECNLRKYSYLLPADIIGIQSHFSQDEIDFHILEFNSILNVFEGEHPFHNYTVRSK 249 Query: 59 YRKKYHARQSLGNGGLSDR 3 YRKKY RQS GN G+ DR Sbjct: 250 YRKKYQVRQSSGNDGMPDR 268 >ref|XP_007142072.1| hypothetical protein PHAVU_008G250200g [Phaseolus vulgaris] gi|561015205|gb|ESW14066.1| hypothetical protein PHAVU_008G250200g [Phaseolus vulgaris] Length = 512 Score = 149 bits (377), Expect = 6e-34 Identities = 70/79 (88%), Positives = 74/79 (93%) Frame = -2 Query: 239 FDPRRECNLRKYSYLLPADIIGIQSHFSEDEIDFHISEFNSILSVFEGEHPFHNYTVRSK 60 FDPRRECNLRKYSYLLPADIIGIQSHFS+DEIDFHISEFNSIL+VFEGEHPFHNYTVRSK Sbjct: 186 FDPRRECNLRKYSYLLPADIIGIQSHFSKDEIDFHISEFNSILNVFEGEHPFHNYTVRSK 245 Query: 59 YRKKYHARQSLGNGGLSDR 3 YRKKY RQS G+ +SDR Sbjct: 246 YRKKYQVRQSSGSDVMSDR 264 >gb|KRH72778.1| hypothetical protein GLYMA_02G233500 [Glycine max] Length = 400 Score = 149 bits (376), Expect = 8e-34 Identities = 70/79 (88%), Positives = 73/79 (92%) Frame = -2 Query: 239 FDPRRECNLRKYSYLLPADIIGIQSHFSEDEIDFHISEFNSILSVFEGEHPFHNYTVRSK 60 FDPRRECNLRKYSYLLPA IIGIQSHFS+DEIDFHISEFNSIL+VFEGEHPFHNYTVRSK Sbjct: 75 FDPRRECNLRKYSYLLPAGIIGIQSHFSQDEIDFHISEFNSILNVFEGEHPFHNYTVRSK 134 Query: 59 YRKKYHARQSLGNGGLSDR 3 YRKKY RQS GN +SDR Sbjct: 135 YRKKYQVRQSSGNDVMSDR 153 >gb|KHN46103.1| Putative tRNA pseudouridine synthase [Glycine soja] Length = 516 Score = 149 bits (376), Expect = 8e-34 Identities = 70/79 (88%), Positives = 73/79 (92%) Frame = -2 Query: 239 FDPRRECNLRKYSYLLPADIIGIQSHFSEDEIDFHISEFNSILSVFEGEHPFHNYTVRSK 60 FDPRRECNLRKYSYLLPA IIGIQSHFS+DEIDFHISEFNSIL+VFEGEHPFHNYTVRSK Sbjct: 191 FDPRRECNLRKYSYLLPAGIIGIQSHFSQDEIDFHISEFNSILNVFEGEHPFHNYTVRSK 250 Query: 59 YRKKYHARQSLGNGGLSDR 3 YRKKY RQS GN +SDR Sbjct: 251 YRKKYQVRQSSGNDVMSDR 269 >ref|XP_003518334.1| PREDICTED: putative tRNA pseudouridine synthase-like [Glycine max] gi|947124571|gb|KRH72777.1| hypothetical protein GLYMA_02G233500 [Glycine max] Length = 516 Score = 149 bits (376), Expect = 8e-34 Identities = 70/79 (88%), Positives = 73/79 (92%) Frame = -2 Query: 239 FDPRRECNLRKYSYLLPADIIGIQSHFSEDEIDFHISEFNSILSVFEGEHPFHNYTVRSK 60 FDPRRECNLRKYSYLLPA IIGIQSHFS+DEIDFHISEFNSIL+VFEGEHPFHNYTVRSK Sbjct: 191 FDPRRECNLRKYSYLLPAGIIGIQSHFSQDEIDFHISEFNSILNVFEGEHPFHNYTVRSK 250 Query: 59 YRKKYHARQSLGNGGLSDR 3 YRKKY RQS GN +SDR Sbjct: 251 YRKKYQVRQSSGNDVMSDR 269 >ref|XP_014503538.1| PREDICTED: putative tRNA pseudouridine synthase [Vigna radiata var. radiata] Length = 520 Score = 148 bits (374), Expect = 1e-33 Identities = 69/79 (87%), Positives = 74/79 (93%) Frame = -2 Query: 239 FDPRRECNLRKYSYLLPADIIGIQSHFSEDEIDFHISEFNSILSVFEGEHPFHNYTVRSK 60 FDPRRECNLRKYSYLLPADIIGIQSHF++DEIDFHISEFNSIL+VFEGEHPFHNYTVRSK Sbjct: 186 FDPRRECNLRKYSYLLPADIIGIQSHFNKDEIDFHISEFNSILNVFEGEHPFHNYTVRSK 245 Query: 59 YRKKYHARQSLGNGGLSDR 3 YRKKY RQS G+ +SDR Sbjct: 246 YRKKYQVRQSSGSDVMSDR 264 >ref|XP_003615969.1| tRNA pseudouridine synthase [Medicago truncatula] gi|355517304|gb|AES98927.1| tRNA pseudouridine synthase [Medicago truncatula] Length = 483 Score = 144 bits (363), Expect = 3e-32 Identities = 64/78 (82%), Positives = 73/78 (93%) Frame = -2 Query: 239 FDPRRECNLRKYSYLLPADIIGIQSHFSEDEIDFHISEFNSILSVFEGEHPFHNYTVRSK 60 FDPR+EC++RKYSYLLPADIIG+QSHFSEDE DFHISEFNSIL FEG+HPFHNYTVRS Sbjct: 173 FDPRKECSMRKYSYLLPADIIGVQSHFSEDETDFHISEFNSILGAFEGDHPFHNYTVRSV 232 Query: 59 YRKKYHARQSLGNGGLSD 6 YRKK+HAR+S GNGG+S+ Sbjct: 233 YRKKHHARKSPGNGGMSN 250 >ref|XP_010106701.1| Putative tRNA pseudouridine synthase [Morus notabilis] gi|587924015|gb|EXC11333.1| Putative tRNA pseudouridine synthase [Morus notabilis] Length = 481 Score = 126 bits (316), Expect = 7e-27 Identities = 54/74 (72%), Positives = 68/74 (91%) Frame = -2 Query: 239 FDPRRECNLRKYSYLLPADIIGIQSHFSEDEIDFHISEFNSILSVFEGEHPFHNYTVRSK 60 FDPRRECNLRKYSYLLPAD++GI+S+F+ D+IDFHIS+FN IL+ FEG+HPFHNYT+RSK Sbjct: 180 FDPRRECNLRKYSYLLPADVVGIKSNFTTDKIDFHISDFNEILNTFEGDHPFHNYTMRSK 239 Query: 59 YRKKYHARQSLGNG 18 YRK++ A++S NG Sbjct: 240 YRKQFPAKKSYKNG 253 >ref|XP_007207376.1| hypothetical protein PRUPE_ppa004352mg [Prunus persica] gi|462403018|gb|EMJ08575.1| hypothetical protein PRUPE_ppa004352mg [Prunus persica] Length = 515 Score = 124 bits (312), Expect = 2e-26 Identities = 55/77 (71%), Positives = 67/77 (87%) Frame = -2 Query: 239 FDPRRECNLRKYSYLLPADIIGIQSHFSEDEIDFHISEFNSILSVFEGEHPFHNYTVRSK 60 FDPR+ECNLR YSYLLPAD+IGI+SHFS EID+HIS+FNSIL+ FEGEHPFHNYT+RSK Sbjct: 178 FDPRKECNLRMYSYLLPADVIGIKSHFSSAEIDYHISDFNSILNCFEGEHPFHNYTIRSK 237 Query: 59 YRKKYHARQSLGNGGLS 9 YR+K ++S +G +S Sbjct: 238 YRRKLPVKKSRRHGSVS 254 >ref|XP_008384725.1| PREDICTED: putative tRNA pseudouridine synthase [Malus domestica] Length = 530 Score = 124 bits (310), Expect = 4e-26 Identities = 54/77 (70%), Positives = 66/77 (85%) Frame = -2 Query: 239 FDPRRECNLRKYSYLLPADIIGIQSHFSEDEIDFHISEFNSILSVFEGEHPFHNYTVRSK 60 FDPR+ECNLR YSYLLPA++IGI+SH + DEID+HIS+FN+I+ FEGEHPFHNYT+RSK Sbjct: 180 FDPRKECNLRMYSYLLPAEVIGIKSHLNADEIDYHISDFNNIIKAFEGEHPFHNYTIRSK 239 Query: 59 YRKKYHARQSLGNGGLS 9 YR KY A+QS G +S Sbjct: 240 YRSKYPAKQSPKXGKVS 256 >gb|KHN46102.1| Putative tRNA pseudouridine synthase [Glycine soja] Length = 478 Score = 123 bits (308), Expect = 6e-26 Identities = 59/79 (74%), Positives = 66/79 (83%) Frame = -2 Query: 239 FDPRRECNLRKYSYLLPADIIGIQSHFSEDEIDFHISEFNSILSVFEGEHPFHNYTVRSK 60 FDPR+EC LRKYSYLLPA+IIGIQSHFS DE+D+HISEFN IL+VFEG HPFHNYT RSK Sbjct: 156 FDPRKECILRKYSYLLPAEIIGIQSHFS-DEVDYHISEFNDILNVFEGIHPFHNYTARSK 214 Query: 59 YRKKYHARQSLGNGGLSDR 3 YRK++ RQS G S R Sbjct: 215 YRKQFPNRQSSSKSGTSAR 233 >ref|XP_006575439.1| PREDICTED: putative tRNA pseudouridine synthase-like isoform X5 [Glycine max] gi|947124577|gb|KRH72783.1| hypothetical protein GLYMA_02G233600 [Glycine max] gi|947124578|gb|KRH72784.1| hypothetical protein GLYMA_02G233600 [Glycine max] Length = 403 Score = 123 bits (308), Expect = 6e-26 Identities = 59/79 (74%), Positives = 66/79 (83%) Frame = -2 Query: 239 FDPRRECNLRKYSYLLPADIIGIQSHFSEDEIDFHISEFNSILSVFEGEHPFHNYTVRSK 60 FDPR+EC LRKYSYLLPA+IIGIQSHFS DE+D+HISEFN IL+VFEG HPFHNYT RSK Sbjct: 71 FDPRKECILRKYSYLLPAEIIGIQSHFS-DEVDYHISEFNDILNVFEGIHPFHNYTARSK 129 Query: 59 YRKKYHARQSLGNGGLSDR 3 YRK++ RQS G S R Sbjct: 130 YRKQFPNRQSSSKSGTSAR 148 >ref|XP_006575435.1| PREDICTED: putative tRNA pseudouridine synthase-like isoform X1 [Glycine max] gi|571441413|ref|XP_006575436.1| PREDICTED: putative tRNA pseudouridine synthase-like isoform X2 [Glycine max] gi|571441415|ref|XP_006575437.1| PREDICTED: putative tRNA pseudouridine synthase-like isoform X3 [Glycine max] gi|571441417|ref|XP_006575438.1| PREDICTED: putative tRNA pseudouridine synthase-like isoform X4 [Glycine max] gi|947124573|gb|KRH72779.1| hypothetical protein GLYMA_02G233600 [Glycine max] gi|947124574|gb|KRH72780.1| hypothetical protein GLYMA_02G233600 [Glycine max] gi|947124575|gb|KRH72781.1| hypothetical protein GLYMA_02G233600 [Glycine max] gi|947124576|gb|KRH72782.1| hypothetical protein GLYMA_02G233600 [Glycine max] Length = 493 Score = 123 bits (308), Expect = 6e-26 Identities = 59/79 (74%), Positives = 66/79 (83%) Frame = -2 Query: 239 FDPRRECNLRKYSYLLPADIIGIQSHFSEDEIDFHISEFNSILSVFEGEHPFHNYTVRSK 60 FDPR+EC LRKYSYLLPA+IIGIQSHFS DE+D+HISEFN IL+VFEG HPFHNYT RSK Sbjct: 161 FDPRKECILRKYSYLLPAEIIGIQSHFS-DEVDYHISEFNDILNVFEGIHPFHNYTARSK 219 Query: 59 YRKKYHARQSLGNGGLSDR 3 YRK++ RQS G S R Sbjct: 220 YRKQFPNRQSSSKSGTSAR 238 >ref|XP_007017040.1| Pseudouridine synthase family protein [Theobroma cacao] gi|508787403|gb|EOY34659.1| Pseudouridine synthase family protein [Theobroma cacao] Length = 507 Score = 122 bits (306), Expect = 1e-25 Identities = 56/74 (75%), Positives = 65/74 (87%) Frame = -2 Query: 239 FDPRRECNLRKYSYLLPADIIGIQSHFSEDEIDFHISEFNSILSVFEGEHPFHNYTVRSK 60 FDPRRECNLRKYSYLLPA+IIGI+SHFSE EI+ HIS+FNSIL+ FEGEHPFHNYT R+K Sbjct: 173 FDPRRECNLRKYSYLLPAEIIGIKSHFSEAEINHHISDFNSILNCFEGEHPFHNYTQRAK 232 Query: 59 YRKKYHARQSLGNG 18 YR++ RQ+ NG Sbjct: 233 YRRQIPPRQTARNG 246 >ref|XP_009369541.1| PREDICTED: putative tRNA pseudouridine synthase [Pyrus x bretschneideri] Length = 531 Score = 122 bits (305), Expect = 1e-25 Identities = 56/80 (70%), Positives = 67/80 (83%), Gaps = 3/80 (3%) Frame = -2 Query: 239 FDPRRECNLRKYSYLLPA---DIIGIQSHFSEDEIDFHISEFNSILSVFEGEHPFHNYTV 69 FDPR+ECNLR YSYLLPA ++IGI+SHF+ DEID+HIS+FN IL FEGEHPFHNYT+ Sbjct: 180 FDPRKECNLRMYSYLLPAVPAEVIGIKSHFNADEIDYHISDFNKILKAFEGEHPFHNYTI 239 Query: 68 RSKYRKKYHARQSLGNGGLS 9 RSKYR KY A+QS +G +S Sbjct: 240 RSKYRSKYPAKQSPKHGKVS 259 >ref|XP_012078415.1| PREDICTED: putative tRNA pseudouridine synthase isoform X2 [Jatropha curcas] Length = 505 Score = 121 bits (304), Expect = 2e-25 Identities = 54/70 (77%), Positives = 64/70 (91%) Frame = -2 Query: 239 FDPRRECNLRKYSYLLPADIIGIQSHFSEDEIDFHISEFNSILSVFEGEHPFHNYTVRSK 60 FDPRREC+ RKYSYLLPA+IIGI+SHFS+ EIDFH+S+FN ILS FEGEHPFHNYTVRSK Sbjct: 176 FDPRRECDQRKYSYLLPAEIIGIKSHFSQAEIDFHLSDFNDILSAFEGEHPFHNYTVRSK 235 Query: 59 YRKKYHARQS 30 YRK++ A ++ Sbjct: 236 YRKQFPASKT 245 >ref|XP_012078395.1| PREDICTED: putative tRNA pseudouridine synthase isoform X1 [Jatropha curcas] gi|802540814|ref|XP_012078403.1| PREDICTED: putative tRNA pseudouridine synthase isoform X1 [Jatropha curcas] gi|802540816|ref|XP_012078410.1| PREDICTED: putative tRNA pseudouridine synthase isoform X1 [Jatropha curcas] gi|643740045|gb|KDP45731.1| hypothetical protein JCGZ_17338 [Jatropha curcas] Length = 516 Score = 121 bits (304), Expect = 2e-25 Identities = 54/70 (77%), Positives = 64/70 (91%) Frame = -2 Query: 239 FDPRRECNLRKYSYLLPADIIGIQSHFSEDEIDFHISEFNSILSVFEGEHPFHNYTVRSK 60 FDPRREC+ RKYSYLLPA+IIGI+SHFS+ EIDFH+S+FN ILS FEGEHPFHNYTVRSK Sbjct: 187 FDPRRECDQRKYSYLLPAEIIGIKSHFSQAEIDFHLSDFNDILSAFEGEHPFHNYTVRSK 246 Query: 59 YRKKYHARQS 30 YRK++ A ++ Sbjct: 247 YRKQFPASKT 256 >gb|KJB20490.1| hypothetical protein B456_003G151400 [Gossypium raimondii] Length = 379 Score = 121 bits (303), Expect = 2e-25 Identities = 54/74 (72%), Positives = 65/74 (87%) Frame = -2 Query: 239 FDPRRECNLRKYSYLLPADIIGIQSHFSEDEIDFHISEFNSILSVFEGEHPFHNYTVRSK 60 FDPRRECNLRKYSYLLPA+IIGI+SHF+E E ++HIS+FNSIL+ FEGEHPFHNYT R+K Sbjct: 46 FDPRRECNLRKYSYLLPAEIIGIKSHFTEAETNYHISDFNSILNCFEGEHPFHNYTQRAK 105 Query: 59 YRKKYHARQSLGNG 18 YR++ RQ+ NG Sbjct: 106 YRRRVPPRQTARNG 119