BLASTX nr result
ID: Wisteria21_contig00036778
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00036778 (310 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006580595.1| PREDICTED: probable LRR receptor-like serine... 67 4e-09 ref|XP_013447028.1| LRR receptor-like kinase family protein [Med... 67 5e-09 ref|XP_013447026.1| LRR receptor-like kinase family protein [Med... 67 5e-09 ref|XP_003630536.2| LRR receptor-like kinase family protein [Med... 67 5e-09 ref|XP_007160045.1| hypothetical protein PHAVU_002G287900g [Phas... 65 3e-08 ref|XP_013453406.1| LRR receptor-like kinase [Medicago truncatul... 61 3e-07 ref|XP_013453407.1| LRR receptor-like kinase [Medicago truncatul... 61 3e-07 ref|XP_003611107.1| LRR receptor-like kinase [Medicago truncatul... 61 3e-07 ref|XP_006590526.1| PREDICTED: probable LRR receptor-like serine... 60 6e-07 ref|XP_006573774.1| PREDICTED: probable LRR receptor-like serine... 60 6e-07 ref|XP_006584713.1| PREDICTED: probable LRR receptor-like serine... 59 1e-06 ref|XP_012574551.1| PREDICTED: probable LRR receptor-like serine... 59 2e-06 ref|XP_008360704.1| PREDICTED: probable LRR receptor-like serine... 57 7e-06 ref|XP_004503764.1| PREDICTED: probable LRR receptor-like serine... 57 7e-06 >ref|XP_006580595.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g63430-like [Glycine max] gi|947111527|gb|KRH59853.1| hypothetical protein GLYMA_05G206300 [Glycine max] Length = 656 Score = 67.4 bits (163), Expect = 4e-09 Identities = 39/50 (78%), Positives = 41/50 (82%) Frame = -2 Query: 150 MKLCTSFLFLCLVISTLSFVASGTVAFNEVLALTTFKEAVYEDPNLVLSN 1 MKL TSFLFL LV S LSFVAS V NEVLAL TFKEAVYEDP++VLSN Sbjct: 1 MKLYTSFLFLALV-SMLSFVASVMVPKNEVLALKTFKEAVYEDPHMVLSN 49 >ref|XP_013447028.1| LRR receptor-like kinase family protein [Medicago truncatula] gi|657375830|gb|KEH21055.1| LRR receptor-like kinase family protein [Medicago truncatula] Length = 592 Score = 67.0 bits (162), Expect = 5e-09 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = -2 Query: 150 MKLCTSFLFLCLVISTLSFVASGTVAFNEVLALTTFKEAVYEDPNLVLSN 1 MKLCTS LF+ LV S LSFVAS V NEV AL+TFKEAVYEDP++VLSN Sbjct: 1 MKLCTSLLFMGLV-SMLSFVASAMVVSNEVGALSTFKEAVYEDPHMVLSN 49 >ref|XP_013447026.1| LRR receptor-like kinase family protein [Medicago truncatula] gi|657375828|gb|KEH21053.1| LRR receptor-like kinase family protein [Medicago truncatula] Length = 521 Score = 67.0 bits (162), Expect = 5e-09 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = -2 Query: 150 MKLCTSFLFLCLVISTLSFVASGTVAFNEVLALTTFKEAVYEDPNLVLSN 1 MKLCTS LF+ LV S LSFVAS V NEV AL+TFKEAVYEDP++VLSN Sbjct: 1 MKLCTSLLFMGLV-SMLSFVASAMVVSNEVGALSTFKEAVYEDPHMVLSN 49 >ref|XP_003630536.2| LRR receptor-like kinase family protein [Medicago truncatula] gi|657375827|gb|AET05012.2| LRR receptor-like kinase family protein [Medicago truncatula] Length = 658 Score = 67.0 bits (162), Expect = 5e-09 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = -2 Query: 150 MKLCTSFLFLCLVISTLSFVASGTVAFNEVLALTTFKEAVYEDPNLVLSN 1 MKLCTS LF+ LV S LSFVAS V NEV AL+TFKEAVYEDP++VLSN Sbjct: 1 MKLCTSLLFMGLV-SMLSFVASAMVVSNEVGALSTFKEAVYEDPHMVLSN 49 >ref|XP_007160045.1| hypothetical protein PHAVU_002G287900g [Phaseolus vulgaris] gi|561033460|gb|ESW32039.1| hypothetical protein PHAVU_002G287900g [Phaseolus vulgaris] Length = 661 Score = 64.7 bits (156), Expect = 3e-08 Identities = 37/50 (74%), Positives = 39/50 (78%) Frame = -2 Query: 150 MKLCTSFLFLCLVISTLSFVASGTVAFNEVLALTTFKEAVYEDPNLVLSN 1 MKLCTS L L LV S LSFVAS V NEVLAL TFKEAVYEDP++ LSN Sbjct: 1 MKLCTSLLLLGLV-SMLSFVASVRVPSNEVLALKTFKEAVYEDPHMALSN 49 >ref|XP_013453406.1| LRR receptor-like kinase [Medicago truncatula] gi|657383851|gb|KEH27436.1| LRR receptor-like kinase [Medicago truncatula] Length = 528 Score = 61.2 bits (147), Expect = 3e-07 Identities = 34/50 (68%), Positives = 38/50 (76%) Frame = -2 Query: 150 MKLCTSFLFLCLVISTLSFVASGTVAFNEVLALTTFKEAVYEDPNLVLSN 1 MK SFL L L IST+S V S T+ NEV ALT+FKEA+YEDPNLVLSN Sbjct: 1 MKFLASFLVLSL-ISTISLVNSDTLPSNEVWALTSFKEAIYEDPNLVLSN 49 >ref|XP_013453407.1| LRR receptor-like kinase [Medicago truncatula] gi|657383850|gb|KEH27435.1| LRR receptor-like kinase [Medicago truncatula] Length = 591 Score = 61.2 bits (147), Expect = 3e-07 Identities = 34/50 (68%), Positives = 38/50 (76%) Frame = -2 Query: 150 MKLCTSFLFLCLVISTLSFVASGTVAFNEVLALTTFKEAVYEDPNLVLSN 1 MK SFL L L IST+S V S T+ NEV ALT+FKEA+YEDPNLVLSN Sbjct: 1 MKFLASFLVLSL-ISTISLVNSDTLPSNEVWALTSFKEAIYEDPNLVLSN 49 >ref|XP_003611107.1| LRR receptor-like kinase [Medicago truncatula] gi|355512442|gb|AES94065.1| LRR receptor-like kinase [Medicago truncatula] Length = 661 Score = 61.2 bits (147), Expect = 3e-07 Identities = 34/50 (68%), Positives = 38/50 (76%) Frame = -2 Query: 150 MKLCTSFLFLCLVISTLSFVASGTVAFNEVLALTTFKEAVYEDPNLVLSN 1 MK SFL L L IST+S V S T+ NEV ALT+FKEA+YEDPNLVLSN Sbjct: 1 MKFLASFLVLSL-ISTISLVNSDTLPSNEVWALTSFKEAIYEDPNLVLSN 49 >ref|XP_006590526.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g63430-like [Glycine max] gi|734408906|gb|KHN35013.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine soja] gi|947079152|gb|KRH27941.1| hypothetical protein GLYMA_11G024700 [Glycine max] Length = 663 Score = 60.1 bits (144), Expect = 6e-07 Identities = 35/50 (70%), Positives = 36/50 (72%) Frame = -2 Query: 150 MKLCTSFLFLCLVISTLSFVASGTVAFNEVLALTTFKEAVYEDPNLVLSN 1 MK CTS LFL L IS LSFV S V NEV AL +FKEAVYEDP VLSN Sbjct: 1 MKPCTSLLFLAL-ISALSFVVSDMVPSNEVWALRSFKEAVYEDPYQVLSN 49 >ref|XP_006573774.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g63430-like [Glycine max] gi|734388445|gb|KHN25711.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine soja] gi|947129671|gb|KRH77525.1| hypothetical protein GLYMA_01G218800 [Glycine max] Length = 663 Score = 60.1 bits (144), Expect = 6e-07 Identities = 35/50 (70%), Positives = 36/50 (72%) Frame = -2 Query: 150 MKLCTSFLFLCLVISTLSFVASGTVAFNEVLALTTFKEAVYEDPNLVLSN 1 MK CT LFL ISTLSFV S TV NEV AL +FKEAVYEDP VLSN Sbjct: 1 MKPCTLLLFLSF-ISTLSFVVSDTVPSNEVWALRSFKEAVYEDPYQVLSN 49 >ref|XP_006584713.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g63430-like [Glycine max] gi|734363774|gb|KHN16835.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine soja] gi|947092568|gb|KRH41153.1| hypothetical protein GLYMA_08G013200 [Glycine max] gi|947092569|gb|KRH41154.1| hypothetical protein GLYMA_08G013200 [Glycine max] Length = 662 Score = 59.3 bits (142), Expect = 1e-06 Identities = 35/50 (70%), Positives = 38/50 (76%) Frame = -2 Query: 150 MKLCTSFLFLCLVISTLSFVASGTVAFNEVLALTTFKEAVYEDPNLVLSN 1 MKL TS L L LV S LSFVAS + EVLAL TFKEAVYEDP++VLSN Sbjct: 1 MKLYTSLLLLGLV-SMLSFVASVMIPSGEVLALKTFKEAVYEDPHMVLSN 49 >ref|XP_012574551.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g63430 [Cicer arietinum] Length = 662 Score = 58.5 bits (140), Expect = 2e-06 Identities = 32/50 (64%), Positives = 37/50 (74%) Frame = -2 Query: 150 MKLCTSFLFLCLVISTLSFVASGTVAFNEVLALTTFKEAVYEDPNLVLSN 1 M TSFLFLCL ST+S V S T+ NEV ALT+FKE++YEDP L LSN Sbjct: 1 MNFFTSFLFLCL-FSTISLVDSVTLPPNEVWALTSFKESIYEDPYLALSN 49 >ref|XP_008360704.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g63430 [Malus domestica] Length = 656 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = -2 Query: 150 MKLCTSFLFLCLVISTLSFVASGTVAFNEVLALTTFKEAVYEDPNLVLS 4 M+ SF FLC +IS + V + A EVLALTTFKEA+YEDP+LVLS Sbjct: 1 MRSFASFQFLCCLISGVLLVGGESFASKEVLALTTFKEAIYEDPHLVLS 49 >ref|XP_004503764.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g63430 [Cicer arietinum] Length = 662 Score = 56.6 bits (135), Expect = 7e-06 Identities = 32/50 (64%), Positives = 35/50 (70%) Frame = -2 Query: 150 MKLCTSFLFLCLVISTLSFVASGTVAFNEVLALTTFKEAVYEDPNLVLSN 1 MK TS LFL LV S FV G V NEV AL TFKEAVY+DP++VLSN Sbjct: 1 MKFFTSLLFLSLV-SMFPFVVFGMVVSNEVWALKTFKEAVYDDPHMVLSN 49