BLASTX nr result
ID: Wisteria21_contig00036703
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00036703 (259 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN05236.1| Putative receptor-like serine/threonine-protein k... 86 1e-14 ref|XP_003546407.1| PREDICTED: probable receptor-like serine/thr... 86 1e-14 ref|XP_014492790.1| PREDICTED: cadmium/zinc-transporting ATPase ... 84 3e-14 gb|KOM39815.1| hypothetical protein LR48_Vigan04g001300 [Vigna a... 84 3e-14 ref|XP_007138821.1| hypothetical protein PHAVU_009G240100g [Phas... 84 3e-14 gb|KDO43854.1| hypothetical protein CISIN_1g016594mg [Citrus sin... 84 4e-14 ref|XP_006453346.1| hypothetical protein CICLE_v10008604mg [Citr... 84 4e-14 gb|KRH02853.1| hypothetical protein GLYMA_17G062300 [Glycine max] 82 2e-13 gb|KRH02852.1| hypothetical protein GLYMA_17G062300 [Glycine max] 82 2e-13 ref|NP_001238599.1| protein kinase family protein [Glycine max] ... 82 2e-13 ref|XP_010046976.1| PREDICTED: probable receptor-like serine/thr... 82 2e-13 gb|KHN45232.1| Putative receptor-like serine/threonine-protein k... 81 3e-13 ref|XP_012075108.1| PREDICTED: probable receptor-like serine/thr... 81 3e-13 ref|XP_003533716.1| PREDICTED: probable receptor-like serine/thr... 81 3e-13 ref|XP_011043949.1| PREDICTED: probable receptor-like serine/thr... 81 3e-13 ref|XP_011043948.1| PREDICTED: probable receptor-like serine/thr... 81 3e-13 ref|XP_004507866.1| PREDICTED: probable receptor-like serine/thr... 80 6e-13 ref|XP_011009414.1| PREDICTED: probable receptor-like serine/thr... 80 8e-13 ref|XP_002325042.1| hypothetical protein POPTR_0018s09860g [Popu... 80 8e-13 ref|XP_008223769.1| PREDICTED: probable receptor-like serine/thr... 79 1e-12 >gb|KHN05236.1| Putative receptor-like serine/threonine-protein kinase [Glycine soja] Length = 371 Score = 85.5 bits (210), Expect = 1e-14 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -1 Query: 259 PILDKGEIEKLVDPRLGGAYDVTQFNRLAFAASLCIRASSTWRPT 125 PIL+KGEIEKLVDPRLGGAYDVTQFNR+AFAASLCIRAS+T RPT Sbjct: 272 PILNKGEIEKLVDPRLGGAYDVTQFNRVAFAASLCIRASATCRPT 316 >ref|XP_003546407.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670-like [Glycine max] gi|947062977|gb|KRH12238.1| hypothetical protein GLYMA_15G161200 [Glycine max] Length = 371 Score = 85.5 bits (210), Expect = 1e-14 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -1 Query: 259 PILDKGEIEKLVDPRLGGAYDVTQFNRLAFAASLCIRASSTWRPT 125 PIL+KGEIEKLVDPRLGGAYDVTQFNR+AFAASLCIRAS+T RPT Sbjct: 272 PILNKGEIEKLVDPRLGGAYDVTQFNRVAFAASLCIRASATCRPT 316 >ref|XP_014492790.1| PREDICTED: cadmium/zinc-transporting ATPase HMA3-like [Vigna radiata var. radiata] Length = 1223 Score = 84.3 bits (207), Expect = 3e-14 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = -1 Query: 259 PILDKGEIEKLVDPRLGGAYDVTQFNRLAFAASLCIRASSTWRPT 125 PIL+KGEIEK+VDPRLGGAYDVTQFNR+AFAASLCIRAS+T RPT Sbjct: 272 PILNKGEIEKVVDPRLGGAYDVTQFNRVAFAASLCIRASATCRPT 316 >gb|KOM39815.1| hypothetical protein LR48_Vigan04g001300 [Vigna angularis] Length = 371 Score = 84.3 bits (207), Expect = 3e-14 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = -1 Query: 259 PILDKGEIEKLVDPRLGGAYDVTQFNRLAFAASLCIRASSTWRPT 125 PIL+KGEIEK+VDPRLGGAYDVTQFNR+AFAASLCIRAS+T RPT Sbjct: 272 PILNKGEIEKVVDPRLGGAYDVTQFNRVAFAASLCIRASATCRPT 316 >ref|XP_007138821.1| hypothetical protein PHAVU_009G240100g [Phaseolus vulgaris] gi|561011908|gb|ESW10815.1| hypothetical protein PHAVU_009G240100g [Phaseolus vulgaris] Length = 371 Score = 84.3 bits (207), Expect = 3e-14 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = -1 Query: 259 PILDKGEIEKLVDPRLGGAYDVTQFNRLAFAASLCIRASSTWRPT 125 PIL+KGEIEK+VDPRLGGAYDVTQFNR+AFAASLCIRAS+T RPT Sbjct: 272 PILNKGEIEKVVDPRLGGAYDVTQFNRVAFAASLCIRASATCRPT 316 >gb|KDO43854.1| hypothetical protein CISIN_1g016594mg [Citrus sinensis] Length = 386 Score = 84.0 bits (206), Expect = 4e-14 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = -1 Query: 259 PILDKGEIEKLVDPRLGGAYDVTQFNRLAFAASLCIRASSTWRPT 125 PIL++GEIEKLVDPRL GAYDVTQ NRLAFAASLCIRAS TWRPT Sbjct: 283 PILNQGEIEKLVDPRLQGAYDVTQLNRLAFAASLCIRASPTWRPT 327 >ref|XP_006453346.1| hypothetical protein CICLE_v10008604mg [Citrus clementina] gi|568840487|ref|XP_006474198.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670-like [Citrus sinensis] gi|557556572|gb|ESR66586.1| hypothetical protein CICLE_v10008604mg [Citrus clementina] Length = 386 Score = 84.0 bits (206), Expect = 4e-14 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = -1 Query: 259 PILDKGEIEKLVDPRLGGAYDVTQFNRLAFAASLCIRASSTWRPT 125 PIL++GEIEKLVDPRL GAYDVTQ NRLAFAASLCIRAS TWRPT Sbjct: 283 PILNQGEIEKLVDPRLQGAYDVTQLNRLAFAASLCIRASPTWRPT 327 >gb|KRH02853.1| hypothetical protein GLYMA_17G062300 [Glycine max] Length = 329 Score = 82.0 bits (201), Expect = 2e-13 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 259 PILDKGEIEKLVDPRLGGAYDVTQFNRLAFAASLCIRASSTWRPT 125 PIL+KGEIE+LVDPRL GAYDVTQ R AFAASLCIRASSTWRPT Sbjct: 280 PILNKGEIEELVDPRLEGAYDVTQLKRFAFAASLCIRASSTWRPT 324 >gb|KRH02852.1| hypothetical protein GLYMA_17G062300 [Glycine max] Length = 333 Score = 82.0 bits (201), Expect = 2e-13 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 259 PILDKGEIEKLVDPRLGGAYDVTQFNRLAFAASLCIRASSTWRPT 125 PIL+KGEIE+LVDPRL GAYDVTQ R AFAASLCIRASSTWRPT Sbjct: 280 PILNKGEIEELVDPRLEGAYDVTQLKRFAFAASLCIRASSTWRPT 324 >ref|NP_001238599.1| protein kinase family protein [Glycine max] gi|223452335|gb|ACM89495.1| protein kinase family protein [Glycine max] gi|734365225|gb|KHN17604.1| Putative receptor-like serine/threonine-protein kinase [Glycine soja] gi|947053398|gb|KRH02851.1| hypothetical protein GLYMA_17G062300 [Glycine max] Length = 380 Score = 82.0 bits (201), Expect = 2e-13 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 259 PILDKGEIEKLVDPRLGGAYDVTQFNRLAFAASLCIRASSTWRPT 125 PIL+KGEIE+LVDPRL GAYDVTQ R AFAASLCIRASSTWRPT Sbjct: 280 PILNKGEIEELVDPRLEGAYDVTQLKRFAFAASLCIRASSTWRPT 324 >ref|XP_010046976.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 [Eucalyptus grandis] gi|629114022|gb|KCW78697.1| hypothetical protein EUGRSUZ_C00149 [Eucalyptus grandis] Length = 388 Score = 81.6 bits (200), Expect = 2e-13 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = -1 Query: 259 PILDKGEIEKLVDPRLGGAYDVTQFNRLAFAASLCIRASSTWRPT 125 PIL++GEIEKLVDPRLGGAYDV+Q RLAFAASLCIR+SS WRPT Sbjct: 283 PILNQGEIEKLVDPRLGGAYDVSQMKRLAFAASLCIRSSSMWRPT 327 >gb|KHN45232.1| Putative receptor-like serine/threonine-protein kinase [Glycine soja] Length = 371 Score = 81.3 bits (199), Expect = 3e-13 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -1 Query: 259 PILDKGEIEKLVDPRLGGAYDVTQFNRLAFAASLCIRASSTWRP 128 PIL KGEIE LVDPRLGGAYDVTQFNR+AFAASLCIRAS+T RP Sbjct: 272 PILSKGEIENLVDPRLGGAYDVTQFNRVAFAASLCIRASATCRP 315 >ref|XP_012075108.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 [Jatropha curcas] gi|643726709|gb|KDP35357.1| hypothetical protein JCGZ_10341 [Jatropha curcas] Length = 380 Score = 81.3 bits (199), Expect = 3e-13 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -1 Query: 259 PILDKGEIEKLVDPRLGGAYDVTQFNRLAFAASLCIRASSTWRPT 125 PIL++GEIE LVDPRLGG+YD TQ RLAFAASLCIRASSTWRPT Sbjct: 274 PILNQGEIESLVDPRLGGSYDPTQLKRLAFAASLCIRASSTWRPT 318 >ref|XP_003533716.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670-like [Glycine max] gi|947088606|gb|KRH37271.1| hypothetical protein GLYMA_09G055400 [Glycine max] Length = 371 Score = 81.3 bits (199), Expect = 3e-13 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -1 Query: 259 PILDKGEIEKLVDPRLGGAYDVTQFNRLAFAASLCIRASSTWRP 128 PIL KGEIE LVDPRLGGAYDVTQFNR+AFAASLCIRAS+T RP Sbjct: 272 PILSKGEIENLVDPRLGGAYDVTQFNRVAFAASLCIRASATCRP 315 >ref|XP_011043949.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 isoform X2 [Populus euphratica] Length = 383 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/45 (84%), Positives = 40/45 (88%) Frame = -1 Query: 259 PILDKGEIEKLVDPRLGGAYDVTQFNRLAFAASLCIRASSTWRPT 125 PIL++GEIEKLVDPRLGG YD TQ RL FAASLCIRASSTWRPT Sbjct: 278 PILNQGEIEKLVDPRLGGTYDATQQKRLGFAASLCIRASSTWRPT 322 >ref|XP_011043948.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 isoform X1 [Populus euphratica] Length = 385 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/45 (84%), Positives = 40/45 (88%) Frame = -1 Query: 259 PILDKGEIEKLVDPRLGGAYDVTQFNRLAFAASLCIRASSTWRPT 125 PIL++GEIEKLVDPRLGG YD TQ RL FAASLCIRASSTWRPT Sbjct: 280 PILNQGEIEKLVDPRLGGTYDATQQKRLGFAASLCIRASSTWRPT 324 >ref|XP_004507866.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 [Cicer arietinum] Length = 380 Score = 80.1 bits (196), Expect = 6e-13 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 259 PILDKGEIEKLVDPRLGGAYDVTQFNRLAFAASLCIRASSTWRPT 125 PIL+KGEIE+LVD RL GAYDVTQ RLAFAASLCIRASSTWRPT Sbjct: 280 PILNKGEIEELVDVRLEGAYDVTQLKRLAFAASLCIRASSTWRPT 324 >ref|XP_011009414.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 [Populus euphratica] Length = 386 Score = 79.7 bits (195), Expect = 8e-13 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -1 Query: 259 PILDKGEIEKLVDPRLGGAYDVTQFNRLAFAASLCIRASSTWRPT 125 PIL +GEIEKLVDPRLGG Y++TQ RL F+ASLCIRASSTWRPT Sbjct: 280 PILSRGEIEKLVDPRLGGIYNITQLKRLGFSASLCIRASSTWRPT 324 >ref|XP_002325042.1| hypothetical protein POPTR_0018s09860g [Populus trichocarpa] gi|222866476|gb|EEF03607.1| hypothetical protein POPTR_0018s09860g [Populus trichocarpa] Length = 340 Score = 79.7 bits (195), Expect = 8e-13 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = -1 Query: 259 PILDKGEIEKLVDPRLGGAYDVTQFNRLAFAASLCIRASSTWRPT 125 PIL++GEIE+LVDPRLGG YD TQ RL FAASLCIRASSTWRPT Sbjct: 280 PILNQGEIERLVDPRLGGTYDATQQKRLGFAASLCIRASSTWRPT 324 >ref|XP_008223769.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 [Prunus mume] Length = 385 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = -1 Query: 259 PILDKGEIEKLVDPRLGGAYDVTQFNRLAFAASLCIRASSTWRPT 125 PIL++GEIEKLVDPRL GAYDVT+ RLAFA SLCIRAS TWRPT Sbjct: 282 PILNQGEIEKLVDPRLRGAYDVTELKRLAFAGSLCIRASPTWRPT 326