BLASTX nr result
ID: Wisteria21_contig00036671
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00036671 (296 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011024611.1| PREDICTED: galacturonosyltransferase 8 [Popu... 67 5e-09 ref|XP_002301803.1| hypothetical protein POPTR_0002s24790g [Popu... 67 5e-09 gb|ABK92560.1| unknown [Populus trichocarpa] 67 5e-09 ref|XP_014498202.1| PREDICTED: galacturonosyltransferase 8 [Vign... 67 7e-09 gb|KOM37846.1| hypothetical protein LR48_Vigan03g122800 [Vigna a... 67 7e-09 ref|XP_012085051.1| PREDICTED: galacturonosyltransferase 8 [Jatr... 67 7e-09 ref|XP_007140673.1| hypothetical protein PHAVU_008G132200g [Phas... 67 7e-09 ref|XP_006584621.1| PREDICTED: uncharacterized protein LOC100817... 67 7e-09 ref|XP_003552108.1| PREDICTED: galacturonosyltransferase 8-like ... 67 7e-09 ref|NP_001242612.1| uncharacterized protein LOC100817076 [Glycin... 67 7e-09 ref|XP_012473959.1| PREDICTED: galacturonosyltransferase 8 isofo... 66 9e-09 gb|KJB08801.1| hypothetical protein B456_001G104800 [Gossypium r... 66 9e-09 gb|KHG16505.1| Galacturonosyltransferase 8 -like protein [Gossyp... 66 9e-09 ref|XP_004515038.1| PREDICTED: galacturonosyltransferase 8 [Cice... 66 9e-09 ref|XP_010036787.1| PREDICTED: galacturonosyltransferase 8 [Euca... 66 1e-08 ref|XP_010104168.1| Galacturonosyltransferase 8 [Morus notabilis... 65 2e-08 ref|XP_014503846.1| PREDICTED: galacturonosyltransferase 8-like ... 65 3e-08 ref|XP_013657061.1| PREDICTED: galacturonosyltransferase 8-like ... 65 3e-08 gb|KOM46306.1| hypothetical protein LR48_Vigan07g001000 [Vigna a... 65 3e-08 ref|NP_189150.1| Galacturonosyltransferase 8 [Arabidopsis thalia... 65 3e-08 >ref|XP_011024611.1| PREDICTED: galacturonosyltransferase 8 [Populus euphratica] Length = 554 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 294 PWLDIAISKFKPLWTKFVDYELEFVQACNFGL 199 PWLDIA+++FKPLWTK VDYELEFVQACNFGL Sbjct: 523 PWLDIAMTQFKPLWTKHVDYELEFVQACNFGL 554 >ref|XP_002301803.1| hypothetical protein POPTR_0002s24790g [Populus trichocarpa] gi|222843529|gb|EEE81076.1| hypothetical protein POPTR_0002s24790g [Populus trichocarpa] Length = 554 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 294 PWLDIAISKFKPLWTKFVDYELEFVQACNFGL 199 PWLDIA+++FKPLWTK VDYELEFVQACNFGL Sbjct: 523 PWLDIAMTQFKPLWTKHVDYELEFVQACNFGL 554 >gb|ABK92560.1| unknown [Populus trichocarpa] Length = 554 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 294 PWLDIAISKFKPLWTKFVDYELEFVQACNFGL 199 PWLDIA+++FKPLWTK VDYELEFVQACNFGL Sbjct: 523 PWLDIAMTQFKPLWTKHVDYELEFVQACNFGL 554 >ref|XP_014498202.1| PREDICTED: galacturonosyltransferase 8 [Vigna radiata var. radiata] Length = 556 Score = 66.6 bits (161), Expect = 7e-09 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -3 Query: 294 PWLDIAISKFKPLWTKFVDYELEFVQACNFGL 199 PWLDIA+++FKPLWTK+VDYEL+FVQACNFG+ Sbjct: 525 PWLDIAMAQFKPLWTKYVDYELDFVQACNFGI 556 >gb|KOM37846.1| hypothetical protein LR48_Vigan03g122800 [Vigna angularis] Length = 516 Score = 66.6 bits (161), Expect = 7e-09 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -3 Query: 294 PWLDIAISKFKPLWTKFVDYELEFVQACNFGL 199 PWLDIA+++FKPLWTK+VDYEL+FVQACNFG+ Sbjct: 485 PWLDIAMAQFKPLWTKYVDYELDFVQACNFGI 516 >ref|XP_012085051.1| PREDICTED: galacturonosyltransferase 8 [Jatropha curcas] gi|643713687|gb|KDP26352.1| hypothetical protein JCGZ_17510 [Jatropha curcas] Length = 560 Score = 66.6 bits (161), Expect = 7e-09 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -3 Query: 294 PWLDIAISKFKPLWTKFVDYELEFVQACNFGL 199 PWLDIA+++FKPLWTK+VDYE+EFVQ+CNFGL Sbjct: 529 PWLDIAMTQFKPLWTKYVDYEMEFVQSCNFGL 560 >ref|XP_007140673.1| hypothetical protein PHAVU_008G132200g [Phaseolus vulgaris] gi|561013806|gb|ESW12667.1| hypothetical protein PHAVU_008G132200g [Phaseolus vulgaris] Length = 556 Score = 66.6 bits (161), Expect = 7e-09 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -3 Query: 294 PWLDIAISKFKPLWTKFVDYELEFVQACNFGL 199 PWLDIA+++FKPLWTK+VDYEL+FVQACNFG+ Sbjct: 525 PWLDIAMAQFKPLWTKYVDYELDFVQACNFGI 556 >ref|XP_006584621.1| PREDICTED: uncharacterized protein LOC100817076 isoform X1 [Glycine max] gi|734346087|gb|KHN10961.1| Galacturonosyltransferase 8 [Glycine soja] gi|947098057|gb|KRH46642.1| hypothetical protein GLYMA_08G348000 [Glycine max] Length = 556 Score = 66.6 bits (161), Expect = 7e-09 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -3 Query: 294 PWLDIAISKFKPLWTKFVDYELEFVQACNFGL 199 PWLDIA+++FKPLWTK+VDYEL+FVQACNFG+ Sbjct: 525 PWLDIAMTQFKPLWTKYVDYELDFVQACNFGI 556 >ref|XP_003552108.1| PREDICTED: galacturonosyltransferase 8-like [Glycine max] gi|734422738|gb|KHN41703.1| Galacturonosyltransferase 8 [Glycine soja] gi|947050111|gb|KRG99639.1| hypothetical protein GLYMA_18G159500 [Glycine max] Length = 556 Score = 66.6 bits (161), Expect = 7e-09 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -3 Query: 294 PWLDIAISKFKPLWTKFVDYELEFVQACNFGL 199 PWLDIA+++FKPLWTK+VDYEL+FVQACNFG+ Sbjct: 525 PWLDIAMAQFKPLWTKYVDYELDFVQACNFGI 556 >ref|NP_001242612.1| uncharacterized protein LOC100817076 [Glycine max] gi|255641059|gb|ACU20809.1| unknown [Glycine max] Length = 547 Score = 66.6 bits (161), Expect = 7e-09 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -3 Query: 294 PWLDIAISKFKPLWTKFVDYELEFVQACNFGL 199 PWLDIA+++FKPLWTK+VDYEL+FVQACNFG+ Sbjct: 516 PWLDIAMTQFKPLWTKYVDYELDFVQACNFGI 547 >ref|XP_012473959.1| PREDICTED: galacturonosyltransferase 8 isoform X1 [Gossypium raimondii] gi|763741303|gb|KJB08802.1| hypothetical protein B456_001G104800 [Gossypium raimondii] Length = 569 Score = 66.2 bits (160), Expect = 9e-09 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -3 Query: 294 PWLDIAISKFKPLWTKFVDYELEFVQACNFGL 199 PWLDIA+++FKPLWTK+VDY+LEFVQACNFG+ Sbjct: 538 PWLDIAMNQFKPLWTKYVDYDLEFVQACNFGV 569 >gb|KJB08801.1| hypothetical protein B456_001G104800 [Gossypium raimondii] Length = 396 Score = 66.2 bits (160), Expect = 9e-09 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -3 Query: 294 PWLDIAISKFKPLWTKFVDYELEFVQACNFGL 199 PWLDIA+++FKPLWTK+VDY+LEFVQACNFG+ Sbjct: 365 PWLDIAMNQFKPLWTKYVDYDLEFVQACNFGV 396 >gb|KHG16505.1| Galacturonosyltransferase 8 -like protein [Gossypium arboreum] Length = 569 Score = 66.2 bits (160), Expect = 9e-09 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -3 Query: 294 PWLDIAISKFKPLWTKFVDYELEFVQACNFGL 199 PWLDIA+++FKPLWTK+VDY+LEFVQACNFG+ Sbjct: 538 PWLDIAMNQFKPLWTKYVDYDLEFVQACNFGV 569 >ref|XP_004515038.1| PREDICTED: galacturonosyltransferase 8 [Cicer arietinum] Length = 555 Score = 66.2 bits (160), Expect = 9e-09 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -3 Query: 294 PWLDIAISKFKPLWTKFVDYELEFVQACNFGL 199 PWLDIA+++FKPLW+K+VDYELEFVQACNFG+ Sbjct: 524 PWLDIAMTQFKPLWSKYVDYELEFVQACNFGI 555 >ref|XP_010036787.1| PREDICTED: galacturonosyltransferase 8 [Eucalyptus grandis] gi|629081986|gb|KCW48431.1| hypothetical protein EUGRSUZ_K02133 [Eucalyptus grandis] Length = 555 Score = 65.9 bits (159), Expect = 1e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -3 Query: 294 PWLDIAISKFKPLWTKFVDYELEFVQACNFGL 199 PWLDIA+S FKPLWTK+VDYEL+F+QACNFG+ Sbjct: 524 PWLDIAMSLFKPLWTKYVDYELDFIQACNFGV 555 >ref|XP_010104168.1| Galacturonosyltransferase 8 [Morus notabilis] gi|587911246|gb|EXB99100.1| Galacturonosyltransferase 8 [Morus notabilis] Length = 562 Score = 65.5 bits (158), Expect = 2e-08 Identities = 25/32 (78%), Positives = 32/32 (100%) Frame = -3 Query: 294 PWLDIAISKFKPLWTKFVDYELEFVQACNFGL 199 PWLDIA+++FKPLWTK+VDY+L+FVQACNFG+ Sbjct: 531 PWLDIAMNQFKPLWTKYVDYDLDFVQACNFGI 562 >ref|XP_014503846.1| PREDICTED: galacturonosyltransferase 8-like [Vigna radiata var. radiata] Length = 552 Score = 64.7 bits (156), Expect = 3e-08 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -3 Query: 294 PWLDIAISKFKPLWTKFVDYELEFVQACNF 205 PWLDIA+S+FKPLWTK+VDYELEFV+ACNF Sbjct: 521 PWLDIALSQFKPLWTKYVDYELEFVRACNF 550 >ref|XP_013657061.1| PREDICTED: galacturonosyltransferase 8-like [Brassica napus] Length = 566 Score = 64.7 bits (156), Expect = 3e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -3 Query: 294 PWLDIAISKFKPLWTKFVDYELEFVQACNFGL 199 PWLDIA+++F+PLWTK VDY+LEFVQACNFGL Sbjct: 535 PWLDIAMNQFRPLWTKHVDYDLEFVQACNFGL 566 >gb|KOM46306.1| hypothetical protein LR48_Vigan07g001000 [Vigna angularis] Length = 776 Score = 64.7 bits (156), Expect = 3e-08 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -3 Query: 294 PWLDIAISKFKPLWTKFVDYELEFVQACNF 205 PWLDIA+S+FKPLWTK+VDYELEFV+ACNF Sbjct: 745 PWLDIALSQFKPLWTKYVDYELEFVRACNF 774 >ref|NP_189150.1| Galacturonosyltransferase 8 [Arabidopsis thaliana] gi|26398609|sp|Q9LSG3.1|GAUT8_ARATH RecName: Full=Galacturonosyltransferase 8; AltName: Full=Glycosyltransferase QUASIMODO1 gi|9294170|dbj|BAB02072.1| unnamed protein product [Arabidopsis thaliana] gi|20466217|gb|AAM20426.1| glycosyl transferase, putative [Arabidopsis thaliana] gi|34098907|gb|AAQ56836.1| At3g25140 [Arabidopsis thaliana] gi|332643462|gb|AEE76983.1| Galacturonosyltransferase 8 [Arabidopsis thaliana] gi|591402048|gb|AHL38751.1| glycosyltransferase, partial [Arabidopsis thaliana] Length = 559 Score = 64.7 bits (156), Expect = 3e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -3 Query: 294 PWLDIAISKFKPLWTKFVDYELEFVQACNFGL 199 PWLDIA+++F+PLWTK VDY+LEFVQACNFGL Sbjct: 528 PWLDIAMNQFRPLWTKHVDYDLEFVQACNFGL 559