BLASTX nr result
ID: Wisteria21_contig00036614
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00036614 (253 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004512571.1| PREDICTED: pentatricopeptide repeat-containi... 120 4e-25 ref|XP_014521254.1| PREDICTED: pentatricopeptide repeat-containi... 113 5e-23 gb|KOM26515.1| hypothetical protein LR48_Vigan284s000100 [Vigna ... 113 5e-23 ref|XP_003613018.1| PPR containing plant-like protein [Medicago ... 111 2e-22 ref|XP_007158351.1| hypothetical protein PHAVU_002G145400g [Phas... 110 3e-22 ref|XP_003533421.1| PREDICTED: pentatricopeptide repeat-containi... 101 2e-19 ref|XP_008464832.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_011657336.1| PREDICTED: pentatricopeptide repeat-containi... 74 4e-11 ref|XP_009355363.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-11 ref|XP_009355362.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-11 ref|XP_014492072.1| PREDICTED: pentatricopeptide repeat-containi... 73 9e-11 ref|XP_011458318.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 gb|KOM37996.1| hypothetical protein LR48_Vigan03g137800 [Vigna a... 71 3e-10 ref|XP_008361681.1| PREDICTED: pentatricopeptide repeat-containi... 71 3e-10 ref|XP_007140312.1| hypothetical protein PHAVU_008G101600g [Phas... 71 3e-10 ref|XP_009343801.1| PREDICTED: pentatricopeptide repeat-containi... 71 4e-10 ref|XP_009337024.1| PREDICTED: pentatricopeptide repeat-containi... 71 4e-10 ref|XP_007226363.1| hypothetical protein PRUPE_ppa022421mg [Prun... 71 4e-10 ref|XP_008378934.1| PREDICTED: pentatricopeptide repeat-containi... 70 5e-10 ref|XP_010650766.1| PREDICTED: pentatricopeptide repeat-containi... 70 6e-10 >ref|XP_004512571.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Cicer arietinum] gi|502162660|ref|XP_004512572.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Cicer arietinum] Length = 927 Score = 120 bits (301), Expect = 4e-25 Identities = 59/81 (72%), Positives = 64/81 (79%) Frame = -3 Query: 251 PTHLSSLFNLNPHPLTALNFFQWIHYQHGFTHTVRSYEPXXXXXXXXXXLRAAENVRNSM 72 PTH+SSLFNLN HPLTALNFF+WIH QHGF HTV SY+P LRAAENVRNSM Sbjct: 62 PTHISSLFNLNLHPLTALNFFKWIHQQHGFIHTVHSYQPLLFILVRNGYLRAAENVRNSM 121 Query: 71 IKSSASPHDARFVLNLLRRMN 9 IK+ ASP +ARFVLNLLR MN Sbjct: 122 IKTCASPQEARFVLNLLRLMN 142 >ref|XP_014521254.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Vigna radiata var. radiata] gi|951054535|ref|XP_014521255.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Vigna radiata var. radiata] gi|951054541|ref|XP_014521256.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Vigna radiata var. radiata] gi|951054545|ref|XP_014521257.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Vigna radiata var. radiata] Length = 904 Score = 113 bits (283), Expect = 5e-23 Identities = 57/82 (69%), Positives = 63/82 (76%) Frame = -3 Query: 251 PTHLSSLFNLNPHPLTALNFFQWIHYQHGFTHTVRSYEPXXXXXXXXXXLRAAENVRNSM 72 P+ LSSLFNLNP PLTALNFF+WI ++H F HT+R+YE LRAAENVRNSM Sbjct: 59 PSLLSSLFNLNPDPLTALNFFRWIRHKHSFVHTLRTYESLLLILVRHGTLRAAENVRNSM 118 Query: 71 IKSSASPHDARFVLNLLRRMNT 6 IK AS HDARFVLNLLRRMNT Sbjct: 119 IKCCASAHDARFVLNLLRRMNT 140 >gb|KOM26515.1| hypothetical protein LR48_Vigan284s000100 [Vigna angularis] Length = 904 Score = 113 bits (283), Expect = 5e-23 Identities = 57/82 (69%), Positives = 63/82 (76%) Frame = -3 Query: 251 PTHLSSLFNLNPHPLTALNFFQWIHYQHGFTHTVRSYEPXXXXXXXXXXLRAAENVRNSM 72 P+ LSSLFNLNP PLTALNFF+WI ++H F HT+R+YE LRAAENVRNSM Sbjct: 59 PSLLSSLFNLNPDPLTALNFFRWIRHKHSFVHTLRTYESLLLILVRHGTLRAAENVRNSM 118 Query: 71 IKSSASPHDARFVLNLLRRMNT 6 IK AS HDARFVLNLLRRMNT Sbjct: 119 IKCCASAHDARFVLNLLRRMNT 140 >ref|XP_003613018.1| PPR containing plant-like protein [Medicago truncatula] gi|355514353|gb|AES95976.1| PPR containing plant-like protein [Medicago truncatula] Length = 894 Score = 111 bits (277), Expect = 2e-22 Identities = 57/78 (73%), Positives = 60/78 (76%), Gaps = 1/78 (1%) Frame = -3 Query: 251 PTHLSSLFNL-NPHPLTALNFFQWIHYQHGFTHTVRSYEPXXXXXXXXXXLRAAENVRNS 75 PTHLSSLFN N HPLTALNFF+WIHYQHGF HTV SY+P LRAAENVRNS Sbjct: 69 PTHLSSLFNNPNLHPLTALNFFKWIHYQHGFIHTVHSYQPLLFILVRNGFLRAAENVRNS 128 Query: 74 MIKSSASPHDARFVLNLL 21 MIKS S H+ARFVLNLL Sbjct: 129 MIKSCVSSHEARFVLNLL 146 >ref|XP_007158351.1| hypothetical protein PHAVU_002G145400g [Phaseolus vulgaris] gi|561031766|gb|ESW30345.1| hypothetical protein PHAVU_002G145400g [Phaseolus vulgaris] Length = 904 Score = 110 bits (276), Expect = 3e-22 Identities = 57/82 (69%), Positives = 62/82 (75%) Frame = -3 Query: 251 PTHLSSLFNLNPHPLTALNFFQWIHYQHGFTHTVRSYEPXXXXXXXXXXLRAAENVRNSM 72 P+ LSSLFNLNP PLTALNFF+WI +H F HT+R+YE LRAAENVRNSM Sbjct: 59 PSLLSSLFNLNPDPLTALNFFRWIRRKHSFVHTLRTYESLLLILVRHGTLRAAENVRNSM 118 Query: 71 IKSSASPHDARFVLNLLRRMNT 6 IK ASP DARFVLNLLRRMNT Sbjct: 119 IKCCASPLDARFVLNLLRRMNT 140 >ref|XP_003533421.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X1 [Glycine max] gi|571478486|ref|XP_006587579.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X2 [Glycine max] gi|571478488|ref|XP_006587580.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X3 [Glycine max] gi|947090809|gb|KRH39474.1| hypothetical protein GLYMA_09G200200 [Glycine max] Length = 892 Score = 101 bits (252), Expect = 2e-19 Identities = 51/82 (62%), Positives = 58/82 (70%) Frame = -3 Query: 251 PTHLSSLFNLNPHPLTALNFFQWIHYQHGFTHTVRSYEPXXXXXXXXXXLRAAENVRNSM 72 P+ L SLFNLNP PLTALNFF+WI H F H++ ++ LRAAENVRNSM Sbjct: 53 PSLLCSLFNLNPDPLTALNFFRWIRRHHNFPHSLATHHSLLLLLVRHRTLRAAENVRNSM 112 Query: 71 IKSSASPHDARFVLNLLRRMNT 6 IKS SPHDA F+LNLLRRMNT Sbjct: 113 IKSCTSPHDATFLLNLLRRMNT 134 >ref|XP_008464832.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Cucumis melo] gi|659129763|ref|XP_008464833.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Cucumis melo] gi|659129765|ref|XP_008464834.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Cucumis melo] gi|659129767|ref|XP_008464835.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Cucumis melo] Length = 939 Score = 75.5 bits (184), Expect = 1e-11 Identities = 41/81 (50%), Positives = 50/81 (61%) Frame = -3 Query: 251 PTHLSSLFNLNPHPLTALNFFQWIHYQHGFTHTVRSYEPXXXXXXXXXXLRAAENVRNSM 72 P+H+S+LF LN P TAL FF WI +HGF H V+SY LR AEN+R M Sbjct: 101 PSHISALFALNLDPQTALAFFNWIGQKHGFKHNVQSYVSMLNILVPNGYLRIAENMRILM 160 Query: 71 IKSSASPHDARFVLNLLRRMN 9 IKS+ S +A FVL +LR MN Sbjct: 161 IKSTDSSENAVFVLEMLRSMN 181 >ref|XP_011657336.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Cucumis sativus] gi|778715064|ref|XP_011657338.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Cucumis sativus] gi|778715067|ref|XP_004144290.2| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Cucumis sativus] gi|700192325|gb|KGN47529.1| hypothetical protein Csa_6G355970 [Cucumis sativus] Length = 939 Score = 73.9 bits (180), Expect = 4e-11 Identities = 40/81 (49%), Positives = 50/81 (61%) Frame = -3 Query: 251 PTHLSSLFNLNPHPLTALNFFQWIHYQHGFTHTVRSYEPXXXXXXXXXXLRAAENVRNSM 72 P+H+S+LF LN P TAL FF WI +HGF H V+S+ LR AEN+R M Sbjct: 101 PSHISALFALNLDPQTALAFFNWIGQKHGFKHNVQSHVSMLNILVPNGYLRIAENMRILM 160 Query: 71 IKSSASPHDARFVLNLLRRMN 9 IKS+ S +A FVL +LR MN Sbjct: 161 IKSTDSSENALFVLEMLRSMN 181 >ref|XP_009355363.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X2 [Pyrus x bretschneideri] Length = 851 Score = 73.2 bits (178), Expect = 7e-11 Identities = 38/81 (46%), Positives = 49/81 (60%) Frame = -3 Query: 251 PTHLSSLFNLNPHPLTALNFFQWIHYQHGFTHTVRSYEPXXXXXXXXXXLRAAENVRNSM 72 P+H+SS+F LN P TAL FF WI + G+ HTV + L+ AE +R SM Sbjct: 72 PSHVSSVFALNLDPRTALAFFNWIALKPGYKHTVHCHSSLLNILLPNGFLQVAEKIRISM 131 Query: 71 IKSSASPHDARFVLNLLRRMN 9 IK+S+SP DA FVL LR +N Sbjct: 132 IKASSSPQDALFVLKFLRELN 152 >ref|XP_009355362.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X1 [Pyrus x bretschneideri] Length = 905 Score = 73.2 bits (178), Expect = 7e-11 Identities = 38/81 (46%), Positives = 49/81 (60%) Frame = -3 Query: 251 PTHLSSLFNLNPHPLTALNFFQWIHYQHGFTHTVRSYEPXXXXXXXXXXLRAAENVRNSM 72 P+H+SS+F LN P TAL FF WI + G+ HTV + L+ AE +R SM Sbjct: 72 PSHVSSVFALNLDPRTALAFFNWIALKPGYKHTVHCHSSLLNILLPNGFLQVAEKIRISM 131 Query: 71 IKSSASPHDARFVLNLLRRMN 9 IK+S+SP DA FVL LR +N Sbjct: 132 IKASSSPQDALFVLKFLRELN 152 >ref|XP_014492072.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X1 [Vigna radiata var. radiata] Length = 897 Score = 72.8 bits (177), Expect = 9e-11 Identities = 39/81 (48%), Positives = 47/81 (58%) Frame = -3 Query: 251 PTHLSSLFNLNPHPLTALNFFQWIHYQHGFTHTVRSYEPXXXXXXXXXXLRAAENVRNSM 72 P H+SSL +L P P TAL FF WI + G+ HT +Y LR AE R SM Sbjct: 61 PFHVSSLLHLKPSPQTALQFFNWIATKPGYKHTPFAYASLLNLLVPHGFLRPAETARISM 120 Query: 71 IKSSASPHDARFVLNLLRRMN 9 +K++ SP DARFVL LR MN Sbjct: 121 VKAAGSPDDARFVLAFLRGMN 141 >ref|XP_011458318.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Fragaria vesca subsp. vesca] gi|764530806|ref|XP_011458319.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Fragaria vesca subsp. vesca] gi|764530811|ref|XP_011458320.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Fragaria vesca subsp. vesca] Length = 891 Score = 72.4 bits (176), Expect = 1e-10 Identities = 41/83 (49%), Positives = 52/83 (62%), Gaps = 2/83 (2%) Frame = -3 Query: 251 PTHLSSLFNLNPHPLTALNFFQWIHYQHGFTH--TVRSYEPXXXXXXXXXXLRAAENVRN 78 P+HLSSLF LN HP TAL+FF W+ + T RS+ RAA+ +R Sbjct: 57 PSHLSSLFALNLHPRTALDFFHWLAAKPRLRCKLTPRSHSSLLLLLLQHRFFRAADKIRI 116 Query: 77 SMIKSSASPHDARFVLNLLRRMN 9 SMI++SASP DA FVL+LLRR+N Sbjct: 117 SMIRASASPDDALFVLDLLRRLN 139 >gb|KOM37996.1| hypothetical protein LR48_Vigan03g137800 [Vigna angularis] Length = 893 Score = 71.2 bits (173), Expect = 3e-10 Identities = 37/81 (45%), Positives = 47/81 (58%) Frame = -3 Query: 251 PTHLSSLFNLNPHPLTALNFFQWIHYQHGFTHTVRSYEPXXXXXXXXXXLRAAENVRNSM 72 P H+SSL +L P P TAL FF W+ + G+ HT +Y LR AE R SM Sbjct: 61 PFHVSSLLHLKPSPQTALQFFNWVATKPGYKHTPFAYASLLNLLVPHGFLRPAETARISM 120 Query: 71 IKSSASPHDARFVLNLLRRMN 9 +K++ SP DARFVL LR +N Sbjct: 121 VKAAGSPDDARFVLAFLRGLN 141 >ref|XP_008361681.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Malus domestica] gi|658051905|ref|XP_008361682.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Malus domestica] Length = 905 Score = 71.2 bits (173), Expect = 3e-10 Identities = 37/81 (45%), Positives = 49/81 (60%) Frame = -3 Query: 251 PTHLSSLFNLNPHPLTALNFFQWIHYQHGFTHTVRSYEPXXXXXXXXXXLRAAENVRNSM 72 P+H+SS+F L P TAL FF WI + G+ HTV+ + L+ AE +R SM Sbjct: 72 PSHVSSVFALKLDPQTALGFFNWIXLKPGYKHTVQCHSSLLNILLPNGFLQVAEKIRISM 131 Query: 71 IKSSASPHDARFVLNLLRRMN 9 IK+S+SP DA FVL LR +N Sbjct: 132 IKASSSPQDAVFVLEYLRALN 152 >ref|XP_007140312.1| hypothetical protein PHAVU_008G101600g [Phaseolus vulgaris] gi|561013445|gb|ESW12306.1| hypothetical protein PHAVU_008G101600g [Phaseolus vulgaris] Length = 896 Score = 71.2 bits (173), Expect = 3e-10 Identities = 38/81 (46%), Positives = 47/81 (58%) Frame = -3 Query: 251 PTHLSSLFNLNPHPLTALNFFQWIHYQHGFTHTVRSYEPXXXXXXXXXXLRAAENVRNSM 72 P H+SSL +L P P TAL FF W+ + G+ HT +Y LRAAE R SM Sbjct: 61 PFHVSSLLHLKPSPQTALQFFNWVATKPGYKHTPFAYASLLNLLVPHGLLRAAEAARISM 120 Query: 71 IKSSASPHDARFVLNLLRRMN 9 +K++ SP DAR VL LR MN Sbjct: 121 VKAAGSPDDARIVLAFLRGMN 141 >ref|XP_009343801.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Pyrus x bretschneideri] gi|694432954|ref|XP_009343802.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Pyrus x bretschneideri] Length = 900 Score = 70.9 bits (172), Expect = 4e-10 Identities = 40/82 (48%), Positives = 50/82 (60%), Gaps = 1/82 (1%) Frame = -3 Query: 251 PTHLSSLFNLNPHPLTALNFFQWIHYQHGFTHTVRSYEPXXXXXXXXXXLR-AAENVRNS 75 P+H+SSLF N HP AL+FF+WI + HTV S+ AAE +R S Sbjct: 63 PSHVSSLFARNLHPQIALSFFRWIAGIPRYKHTVHSHSSLLLNILLPNCWLDAAEKIRIS 122 Query: 74 MIKSSASPHDARFVLNLLRRMN 9 M+K+ SP DARFVL+LLRRMN Sbjct: 123 MLKACDSPEDARFVLDLLRRMN 144 >ref|XP_009337024.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Pyrus x bretschneideri] gi|694418004|ref|XP_009337025.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Pyrus x bretschneideri] gi|694418006|ref|XP_009337026.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Pyrus x bretschneideri] gi|694418009|ref|XP_009337027.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Pyrus x bretschneideri] Length = 900 Score = 70.9 bits (172), Expect = 4e-10 Identities = 40/82 (48%), Positives = 50/82 (60%), Gaps = 1/82 (1%) Frame = -3 Query: 251 PTHLSSLFNLNPHPLTALNFFQWIHYQHGFTHTVRSYEPXXXXXXXXXXLR-AAENVRNS 75 P+H+SSLF N HP AL+FF+WI + HTV S+ AAE +R S Sbjct: 63 PSHVSSLFARNLHPQIALSFFRWIAGIPRYKHTVHSHSSLLLNILLPNCWLDAAEKIRIS 122 Query: 74 MIKSSASPHDARFVLNLLRRMN 9 M+K+ SP DARFVL+LLRRMN Sbjct: 123 MLKACDSPEDARFVLDLLRRMN 144 >ref|XP_007226363.1| hypothetical protein PRUPE_ppa022421mg [Prunus persica] gi|462423299|gb|EMJ27562.1| hypothetical protein PRUPE_ppa022421mg [Prunus persica] Length = 845 Score = 70.9 bits (172), Expect = 4e-10 Identities = 38/80 (47%), Positives = 45/80 (56%) Frame = -3 Query: 248 THLSSLFNLNPHPLTALNFFQWIHYQHGFTHTVRSYEPXXXXXXXXXXLRAAENVRNSMI 69 +H+SSLF LN P TAL FF WI + G+ HTV + R AE +R SMI Sbjct: 83 SHVSSLFALNLDPQTALGFFNWIALKPGYRHTVHCHSSLLNILIPNGFFRVAEKIRISMI 142 Query: 68 KSSASPHDARFVLNLLRRMN 9 K+S S DA FVL LR MN Sbjct: 143 KASTSAQDALFVLEFLRGMN 162 >ref|XP_008378934.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Malus domestica] Length = 905 Score = 70.5 bits (171), Expect = 5e-10 Identities = 37/81 (45%), Positives = 48/81 (59%) Frame = -3 Query: 251 PTHLSSLFNLNPHPLTALNFFQWIHYQHGFTHTVRSYEPXXXXXXXXXXLRAAENVRNSM 72 P+H+SS+F L P TAL FF WI + G+ HTV + L+ AE +R SM Sbjct: 72 PSHVSSVFALXLDPRTALAFFNWIALKPGYKHTVHCHSSLLNILLPNGFLQVAEKIRISM 131 Query: 71 IKSSASPHDARFVLNLLRRMN 9 IK+S+SP DA FVL LR +N Sbjct: 132 IKASSSPQDALFVLKFLRELN 152 >ref|XP_010650766.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Vitis vinifera] gi|731391457|ref|XP_010650767.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Vitis vinifera] gi|731391459|ref|XP_010650768.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Vitis vinifera] gi|731391461|ref|XP_010650769.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Vitis vinifera] gi|731391463|ref|XP_010650770.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Vitis vinifera] Length = 913 Score = 70.1 bits (170), Expect = 6e-10 Identities = 38/81 (46%), Positives = 45/81 (55%) Frame = -3 Query: 251 PTHLSSLFNLNPHPLTALNFFQWIHYQHGFTHTVRSYEPXXXXXXXXXXLRAAENVRNSM 72 P+H+SSLF N P TAL+FF WI + GF H V SY L AE +R SM Sbjct: 80 PSHVSSLFAFNLDPQTALSFFNWIALRPGFKHNVHSYSSMLNILIRARLLGVAEKIRISM 139 Query: 71 IKSSASPHDARFVLNLLRRMN 9 IKS S D FVL + R+MN Sbjct: 140 IKSCCSIEDVLFVLEVFRKMN 160