BLASTX nr result
ID: Wisteria21_contig00035834
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00035834 (232 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78981.1| hypothetical protein (mitochondrion) [Vicia faba] 118 2e-24 >gb|AGC78981.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 120 Score = 118 bits (295), Expect = 2e-24 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 58 LNPIHKPGNETKFVPFRQVGKVGIRTHFCFALDSIGTKQRRRRNGERTRAVLLGAKAA 231 +NPIHKPGNETKFVPFRQVGKVGIRTHFCFALD IGTKQRRRRNGERTRAVLLGAKAA Sbjct: 1 MNPIHKPGNETKFVPFRQVGKVGIRTHFCFALDYIGTKQRRRRNGERTRAVLLGAKAA 58