BLASTX nr result
ID: Wisteria21_contig00035691
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00035691 (369 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007210461.1| hypothetical protein PRUPE_ppa015345m2g, par... 121 2e-25 ref|XP_006587436.1| PREDICTED: homeobox-leucine zipper protein H... 120 5e-25 ref|XP_003549189.1| PREDICTED: homeobox-leucine zipper protein H... 120 5e-25 ref|XP_014505752.1| PREDICTED: homeobox-leucine zipper protein H... 119 9e-25 gb|KOM54559.1| hypothetical protein LR48_Vigan10g045100 [Vigna a... 119 9e-25 ref|XP_007152598.1| hypothetical protein PHAVU_004G143500g [Phas... 119 9e-25 ref|XP_008240378.1| PREDICTED: homeobox-leucine zipper protein H... 118 2e-24 ref|XP_012079215.1| PREDICTED: homeobox-leucine zipper protein H... 118 2e-24 ref|XP_011649572.1| PREDICTED: homeobox-leucine zipper protein H... 118 2e-24 ref|XP_011649571.1| PREDICTED: homeobox-leucine zipper protein H... 118 2e-24 ref|XP_011649564.1| PREDICTED: homeobox-leucine zipper protein H... 118 2e-24 ref|XP_008445879.1| PREDICTED: homeobox-leucine zipper protein H... 118 2e-24 ref|XP_004137568.1| PREDICTED: homeobox-leucine zipper protein H... 118 2e-24 ref|XP_013452816.1| homeobox leucine zipper protein [Medicago tr... 117 3e-24 ref|XP_004515249.1| PREDICTED: homeobox-leucine zipper protein H... 117 3e-24 ref|XP_010099679.1| Homeobox-leucine zipper protein HDG11 [Morus... 117 4e-24 ref|XP_008375042.1| PREDICTED: homeobox-leucine zipper protein H... 117 4e-24 ref|XP_008375041.1| PREDICTED: homeobox-leucine zipper protein H... 117 4e-24 ref|XP_003530982.1| PREDICTED: homeobox-leucine zipper protein H... 117 4e-24 ref|XP_003524332.1| PREDICTED: homeobox-leucine zipper protein H... 117 4e-24 >ref|XP_007210461.1| hypothetical protein PRUPE_ppa015345m2g, partial [Prunus persica] gi|462406196|gb|EMJ11660.1| hypothetical protein PRUPE_ppa015345m2g, partial [Prunus persica] Length = 143 Score = 121 bits (303), Expect = 2e-25 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = -2 Query: 182 QRRKKRYHRHTANQIQRLEGMFKQCPHPDEKQWLQLSRELGLAPRLIKFWFQNRRTQMKA 3 QRRKKRYHRHTANQIQ+LEGMFK+CPHPDEKQ LQLSRELGLAPR IKFWFQNRRTQMKA Sbjct: 21 QRRKKRYHRHTANQIQKLEGMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQNRRTQMKA 80 >ref|XP_006587436.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Glycine max] gi|734382312|gb|KHN23587.1| Homeobox-leucine zipper protein HDG11 [Glycine soja] gi|947090274|gb|KRH38939.1| hypothetical protein GLYMA_09G168000 [Glycine max] gi|947090275|gb|KRH38940.1| hypothetical protein GLYMA_09G168000 [Glycine max] Length = 722 Score = 120 bits (300), Expect = 5e-25 Identities = 56/60 (93%), Positives = 57/60 (95%) Frame = -2 Query: 182 QRRKKRYHRHTANQIQRLEGMFKQCPHPDEKQWLQLSRELGLAPRLIKFWFQNRRTQMKA 3 QRRKKRYHRHTANQIQRLE MFK+CPHPDEKQ LQLSRELGLAPR IKFWFQNRRTQMKA Sbjct: 22 QRRKKRYHRHTANQIQRLESMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQNRRTQMKA 81 >ref|XP_003549189.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Glycine max] gi|734385051|gb|KHN24536.1| Homeobox-leucine zipper protein HDG11 [Glycine soja] gi|947060071|gb|KRH09477.1| hypothetical protein GLYMA_16G217800 [Glycine max] gi|947060072|gb|KRH09478.1| hypothetical protein GLYMA_16G217800 [Glycine max] Length = 718 Score = 120 bits (300), Expect = 5e-25 Identities = 56/60 (93%), Positives = 57/60 (95%) Frame = -2 Query: 182 QRRKKRYHRHTANQIQRLEGMFKQCPHPDEKQWLQLSRELGLAPRLIKFWFQNRRTQMKA 3 QRRKKRYHRHTANQIQRLE MFK+CPHPDEKQ LQLSRELGLAPR IKFWFQNRRTQMKA Sbjct: 22 QRRKKRYHRHTANQIQRLESMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQNRRTQMKA 81 >ref|XP_014505752.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Vigna radiata var. radiata] Length = 715 Score = 119 bits (298), Expect = 9e-25 Identities = 55/60 (91%), Positives = 57/60 (95%) Frame = -2 Query: 182 QRRKKRYHRHTANQIQRLEGMFKQCPHPDEKQWLQLSRELGLAPRLIKFWFQNRRTQMKA 3 QRRKKRYHRHTANQIQRLE MFK+CPHPDEKQ +QLSRELGLAPR IKFWFQNRRTQMKA Sbjct: 22 QRRKKRYHRHTANQIQRLESMFKECPHPDEKQRMQLSRELGLAPRQIKFWFQNRRTQMKA 81 >gb|KOM54559.1| hypothetical protein LR48_Vigan10g045100 [Vigna angularis] Length = 715 Score = 119 bits (298), Expect = 9e-25 Identities = 55/60 (91%), Positives = 57/60 (95%) Frame = -2 Query: 182 QRRKKRYHRHTANQIQRLEGMFKQCPHPDEKQWLQLSRELGLAPRLIKFWFQNRRTQMKA 3 QRRKKRYHRHTANQIQRLE MFK+CPHPDEKQ +QLSRELGLAPR IKFWFQNRRTQMKA Sbjct: 22 QRRKKRYHRHTANQIQRLESMFKECPHPDEKQRMQLSRELGLAPRQIKFWFQNRRTQMKA 81 >ref|XP_007152598.1| hypothetical protein PHAVU_004G143500g [Phaseolus vulgaris] gi|561025907|gb|ESW24592.1| hypothetical protein PHAVU_004G143500g [Phaseolus vulgaris] Length = 715 Score = 119 bits (298), Expect = 9e-25 Identities = 55/60 (91%), Positives = 57/60 (95%) Frame = -2 Query: 182 QRRKKRYHRHTANQIQRLEGMFKQCPHPDEKQWLQLSRELGLAPRLIKFWFQNRRTQMKA 3 QRRKKRYHRHTANQIQRLE MFK+CPHPDEKQ +QLSRELGLAPR IKFWFQNRRTQMKA Sbjct: 22 QRRKKRYHRHTANQIQRLESMFKECPHPDEKQRMQLSRELGLAPRQIKFWFQNRRTQMKA 81 >ref|XP_008240378.1| PREDICTED: homeobox-leucine zipper protein HDG11 [Prunus mume] Length = 709 Score = 118 bits (296), Expect = 2e-24 Identities = 55/60 (91%), Positives = 57/60 (95%) Frame = -2 Query: 182 QRRKKRYHRHTANQIQRLEGMFKQCPHPDEKQWLQLSRELGLAPRLIKFWFQNRRTQMKA 3 QRRKKRYHRHTANQIQ+LEGMFK+CPHPDEKQ L LSRELGLAPR IKFWFQNRRTQMKA Sbjct: 21 QRRKKRYHRHTANQIQKLEGMFKECPHPDEKQRLLLSRELGLAPRQIKFWFQNRRTQMKA 80 >ref|XP_012079215.1| PREDICTED: homeobox-leucine zipper protein HDG11 [Jatropha curcas] gi|643740112|gb|KDP45798.1| hypothetical protein JCGZ_17405 [Jatropha curcas] Length = 710 Score = 118 bits (296), Expect = 2e-24 Identities = 55/60 (91%), Positives = 57/60 (95%) Frame = -2 Query: 182 QRRKKRYHRHTANQIQRLEGMFKQCPHPDEKQWLQLSRELGLAPRLIKFWFQNRRTQMKA 3 QRRKKRYHRHTANQIQ+LE MFK+CPHPDEKQ LQLSRELGLAPR IKFWFQNRRTQMKA Sbjct: 27 QRRKKRYHRHTANQIQQLEAMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQNRRTQMKA 86 >ref|XP_011649572.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X4 [Cucumis sativus] Length = 565 Score = 118 bits (295), Expect = 2e-24 Identities = 55/60 (91%), Positives = 56/60 (93%) Frame = -2 Query: 182 QRRKKRYHRHTANQIQRLEGMFKQCPHPDEKQWLQLSRELGLAPRLIKFWFQNRRTQMKA 3 QRRKKRYHRH ANQIQRLE MFK+CPHPDEKQ LQLSRELGLAPR IKFWFQNRRTQMKA Sbjct: 18 QRRKKRYHRHNANQIQRLEAMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQNRRTQMKA 77 >ref|XP_011649571.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X3 [Cucumis sativus] Length = 584 Score = 118 bits (295), Expect = 2e-24 Identities = 55/60 (91%), Positives = 56/60 (93%) Frame = -2 Query: 182 QRRKKRYHRHTANQIQRLEGMFKQCPHPDEKQWLQLSRELGLAPRLIKFWFQNRRTQMKA 3 QRRKKRYHRH ANQIQRLE MFK+CPHPDEKQ LQLSRELGLAPR IKFWFQNRRTQMKA Sbjct: 18 QRRKKRYHRHNANQIQRLEAMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQNRRTQMKA 77 >ref|XP_011649564.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X2 [Cucumis sativus] Length = 601 Score = 118 bits (295), Expect = 2e-24 Identities = 55/60 (91%), Positives = 56/60 (93%) Frame = -2 Query: 182 QRRKKRYHRHTANQIQRLEGMFKQCPHPDEKQWLQLSRELGLAPRLIKFWFQNRRTQMKA 3 QRRKKRYHRH ANQIQRLE MFK+CPHPDEKQ LQLSRELGLAPR IKFWFQNRRTQMKA Sbjct: 18 QRRKKRYHRHNANQIQRLEAMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQNRRTQMKA 77 >ref|XP_008445879.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Cucumis melo] Length = 1107 Score = 118 bits (295), Expect = 2e-24 Identities = 55/60 (91%), Positives = 56/60 (93%) Frame = -2 Query: 182 QRRKKRYHRHTANQIQRLEGMFKQCPHPDEKQWLQLSRELGLAPRLIKFWFQNRRTQMKA 3 QRRKKRYHRH ANQIQRLE MFK+CPHPDEKQ LQLSRELGLAPR IKFWFQNRRTQMKA Sbjct: 18 QRRKKRYHRHNANQIQRLEAMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQNRRTQMKA 77 >ref|XP_004137568.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X1 [Cucumis sativus] gi|700208855|gb|KGN63951.1| hypothetical protein Csa_1G031750 [Cucumis sativus] Length = 705 Score = 118 bits (295), Expect = 2e-24 Identities = 55/60 (91%), Positives = 56/60 (93%) Frame = -2 Query: 182 QRRKKRYHRHTANQIQRLEGMFKQCPHPDEKQWLQLSRELGLAPRLIKFWFQNRRTQMKA 3 QRRKKRYHRH ANQIQRLE MFK+CPHPDEKQ LQLSRELGLAPR IKFWFQNRRTQMKA Sbjct: 18 QRRKKRYHRHNANQIQRLEAMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQNRRTQMKA 77 >ref|XP_013452816.1| homeobox leucine zipper protein [Medicago truncatula] gi|657383058|gb|KEH26844.1| homeobox leucine zipper protein [Medicago truncatula] Length = 728 Score = 117 bits (294), Expect = 3e-24 Identities = 55/60 (91%), Positives = 56/60 (93%) Frame = -2 Query: 182 QRRKKRYHRHTANQIQRLEGMFKQCPHPDEKQWLQLSRELGLAPRLIKFWFQNRRTQMKA 3 QRRKKRYHRHTANQIQRLE MFK+CPHPDEKQ LQLSREL LAPR IKFWFQNRRTQMKA Sbjct: 27 QRRKKRYHRHTANQIQRLEAMFKECPHPDEKQRLQLSRELALAPRQIKFWFQNRRTQMKA 86 >ref|XP_004515249.1| PREDICTED: homeobox-leucine zipper protein HDG11 [Cicer arietinum] Length = 722 Score = 117 bits (294), Expect = 3e-24 Identities = 55/60 (91%), Positives = 56/60 (93%) Frame = -2 Query: 182 QRRKKRYHRHTANQIQRLEGMFKQCPHPDEKQWLQLSRELGLAPRLIKFWFQNRRTQMKA 3 QRRKKRYHRHTANQIQRLE MFK+CPHPDEKQ LQLSREL LAPR IKFWFQNRRTQMKA Sbjct: 25 QRRKKRYHRHTANQIQRLEAMFKECPHPDEKQRLQLSRELALAPRQIKFWFQNRRTQMKA 84 >ref|XP_010099679.1| Homeobox-leucine zipper protein HDG11 [Morus notabilis] gi|587891644|gb|EXB80256.1| Homeobox-leucine zipper protein HDG11 [Morus notabilis] Length = 721 Score = 117 bits (292), Expect = 4e-24 Identities = 54/60 (90%), Positives = 57/60 (95%) Frame = -2 Query: 182 QRRKKRYHRHTANQIQRLEGMFKQCPHPDEKQWLQLSRELGLAPRLIKFWFQNRRTQMKA 3 QRRKKRYHRHTA+QIQ+LE MFK+CPHPDEKQ LQLSRELGLAPR IKFWFQNRRTQMKA Sbjct: 20 QRRKKRYHRHTAHQIQKLESMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQNRRTQMKA 79 >ref|XP_008375042.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X2 [Malus domestica] Length = 561 Score = 117 bits (292), Expect = 4e-24 Identities = 53/60 (88%), Positives = 57/60 (95%) Frame = -2 Query: 182 QRRKKRYHRHTANQIQRLEGMFKQCPHPDEKQWLQLSRELGLAPRLIKFWFQNRRTQMKA 3 QRRKKRYHRHT +QIQRLEGM+K+CPHPDEKQ +QLSRELGLAPR IKFWFQNRRTQMKA Sbjct: 23 QRRKKRYHRHTTHQIQRLEGMYKECPHPDEKQRMQLSRELGLAPRQIKFWFQNRRTQMKA 82 >ref|XP_008375041.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X1 [Malus domestica] Length = 710 Score = 117 bits (292), Expect = 4e-24 Identities = 53/60 (88%), Positives = 57/60 (95%) Frame = -2 Query: 182 QRRKKRYHRHTANQIQRLEGMFKQCPHPDEKQWLQLSRELGLAPRLIKFWFQNRRTQMKA 3 QRRKKRYHRHT +QIQRLEGM+K+CPHPDEKQ +QLSRELGLAPR IKFWFQNRRTQMKA Sbjct: 23 QRRKKRYHRHTTHQIQRLEGMYKECPHPDEKQRMQLSRELGLAPRQIKFWFQNRRTQMKA 82 >ref|XP_003530982.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X1 [Glycine max] gi|571470104|ref|XP_006584922.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X2 [Glycine max] gi|571470106|ref|XP_006584923.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X3 [Glycine max] gi|571470109|ref|XP_006584924.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X4 [Glycine max] gi|571470111|ref|XP_006584925.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X5 [Glycine max] gi|734311705|gb|KHN00122.1| Homeobox-leucine zipper protein HDG11-like protein [Glycine soja] gi|947093313|gb|KRH41898.1| hypothetical protein GLYMA_08G057400 [Glycine max] Length = 721 Score = 117 bits (292), Expect = 4e-24 Identities = 54/60 (90%), Positives = 56/60 (93%) Frame = -2 Query: 182 QRRKKRYHRHTANQIQRLEGMFKQCPHPDEKQWLQLSRELGLAPRLIKFWFQNRRTQMKA 3 Q R+KRYHRHTANQIQRLE MFK+CPHPDEKQ LQLSRELGLAPR IKFWFQNRRTQMKA Sbjct: 22 QERRKRYHRHTANQIQRLESMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQNRRTQMKA 81 >ref|XP_003524332.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Glycine max] gi|734344808|gb|KHN10515.1| Homeobox-leucine zipper protein HDG11 [Glycine soja] gi|947112270|gb|KRH60596.1| hypothetical protein GLYMA_05G248800 [Glycine max] Length = 713 Score = 117 bits (292), Expect = 4e-24 Identities = 54/60 (90%), Positives = 56/60 (93%) Frame = -2 Query: 182 QRRKKRYHRHTANQIQRLEGMFKQCPHPDEKQWLQLSRELGLAPRLIKFWFQNRRTQMKA 3 Q R+KRYHRHTANQIQRLE MFK+CPHPDEKQ LQLSRELGLAPR IKFWFQNRRTQMKA Sbjct: 18 QERRKRYHRHTANQIQRLESMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQNRRTQMKA 77