BLASTX nr result
ID: Wisteria21_contig00035680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00035680 (350 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003630215.2| autophagy-related protein [Medicago truncatu... 57 4e-06 ref|XP_013446863.1| autophagy-related protein [Medicago truncatu... 57 4e-06 >ref|XP_003630215.2| autophagy-related protein [Medicago truncatula] gi|657375609|gb|AET04691.2| autophagy-related protein [Medicago truncatula] Length = 557 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 346 ITTRKTTSDALEEFRGYREMKNLLLTRDSNPRI 248 I TRKTTSDALEEF GYREMKNLL+ RDS P+I Sbjct: 525 IATRKTTSDALEEFHGYREMKNLLVMRDSKPQI 557 >ref|XP_013446863.1| autophagy-related protein [Medicago truncatula] gi|657375610|gb|KEH20890.1| autophagy-related protein [Medicago truncatula] Length = 583 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 346 ITTRKTTSDALEEFRGYREMKNLLLTRDSNPRI 248 I TRKTTSDALEEF GYREMKNLL+ RDS P+I Sbjct: 551 IATRKTTSDALEEFHGYREMKNLLVMRDSKPQI 583