BLASTX nr result
ID: Wisteria21_contig00035099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00035099 (316 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN11385.1| Rho GTPase-activating protein gacA [Glycine soja] 69 2e-09 ref|XP_003554780.1| PREDICTED: rho GTPase-activating protein 3-l... 69 2e-09 ref|XP_007147346.1| hypothetical protein PHAVU_006G116300g [Phas... 67 7e-09 gb|KHN16413.1| Rho GTPase-activating protein gacA [Glycine soja] 64 4e-08 ref|XP_003521820.2| PREDICTED: rho GTPase-activating protein 3-l... 64 4e-08 ref|XP_003627492.2| Rac GTPase activating protein [Medicago trun... 63 8e-08 gb|AAC62625.1| rac GTPase activating protein 2 [Lotus japonicus] 62 1e-07 ref|XP_012437803.1| PREDICTED: rho GTPase-activating protein 5-l... 61 3e-07 gb|KHG26369.1| Rho GTPase-activating gacA [Gossypium arboreum] 61 3e-07 ref|XP_014491629.1| PREDICTED: rho GTPase-activating protein 3-l... 59 1e-06 gb|KOM53006.1| hypothetical protein LR48_Vigan09g166500 [Vigna a... 59 1e-06 ref|XP_004510628.1| PREDICTED: rho GTPase-activating protein 5 [... 59 2e-06 ref|XP_007051458.1| Rho GTPase activating protein with PAK-box/P... 57 4e-06 ref|XP_011038985.1| PREDICTED: rho GTPase-activating protein 3-l... 57 5e-06 ref|XP_002320221.1| hypothetical protein POPTR_0014s09940g [Popu... 57 5e-06 ref|XP_010100679.1| Rho GTPase-activating protein gacA [Morus no... 56 9e-06 >gb|KHN11385.1| Rho GTPase-activating protein gacA [Glycine soja] Length = 497 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -3 Query: 314 RLCRHPVFQLSRPTKKRASLGTVNTRERGGEAWA 213 RLCRHPVFQLS+PTKKRASLG VNTRE GGEAWA Sbjct: 464 RLCRHPVFQLSKPTKKRASLGIVNTREGGGEAWA 497 >ref|XP_003554780.1| PREDICTED: rho GTPase-activating protein 3-like [Glycine max] gi|947047598|gb|KRG97227.1| hypothetical protein GLYMA_19G258900 [Glycine max] Length = 497 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -3 Query: 314 RLCRHPVFQLSRPTKKRASLGTVNTRERGGEAWA 213 RLCRHPVFQLS+PTKKRASLG VNTRE GGEAWA Sbjct: 464 RLCRHPVFQLSKPTKKRASLGIVNTREGGGEAWA 497 >ref|XP_007147346.1| hypothetical protein PHAVU_006G116300g [Phaseolus vulgaris] gi|561020569|gb|ESW19340.1| hypothetical protein PHAVU_006G116300g [Phaseolus vulgaris] Length = 502 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 314 RLCRHPVFQLSRPTKKRASLGTVNTRERGGEAWA 213 RLCRHPVF+LS+PTKKR+SLG VNTRE GGEAWA Sbjct: 469 RLCRHPVFKLSKPTKKRSSLGIVNTREEGGEAWA 502 >gb|KHN16413.1| Rho GTPase-activating protein gacA [Glycine soja] Length = 490 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 314 RLCRHPVFQLSRPTKKRASLGTVNTRERGGEAWA 213 RLCRHPVFQLS+PTKKRASLG VNTRE GGEA A Sbjct: 457 RLCRHPVFQLSKPTKKRASLGVVNTREGGGEALA 490 >ref|XP_003521820.2| PREDICTED: rho GTPase-activating protein 3-like [Glycine max] gi|947120698|gb|KRH68947.1| hypothetical protein GLYMA_03G259800 [Glycine max] Length = 497 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 314 RLCRHPVFQLSRPTKKRASLGTVNTRERGGEAWA 213 RLCRHPVFQLS+PTKKRASLG VNTRE GGEA A Sbjct: 464 RLCRHPVFQLSKPTKKRASLGVVNTREGGGEALA 497 >ref|XP_003627492.2| Rac GTPase activating protein [Medicago truncatula] gi|657372815|gb|AET01968.2| Rac GTPase activating protein [Medicago truncatula] Length = 492 Score = 63.2 bits (152), Expect = 8e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 314 RLCRHPVFQLSRPTKKRASLGTVNTRERGGEAWA 213 +LCRHPVFQLS+P+KK ASLG VNTRE GGEAWA Sbjct: 459 KLCRHPVFQLSKPSKKPASLGIVNTREGGGEAWA 492 >gb|AAC62625.1| rac GTPase activating protein 2 [Lotus japonicus] Length = 424 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 314 RLCRHPVFQLSRPTKKRASLGTVNTRERGGEAWA 213 RLC+HPVFQLS+ TKKRA LG VNTRE GGEAWA Sbjct: 391 RLCQHPVFQLSKSTKKRADLGIVNTREGGGEAWA 424 >ref|XP_012437803.1| PREDICTED: rho GTPase-activating protein 5-like [Gossypium raimondii] gi|763782539|gb|KJB49610.1| hypothetical protein B456_008G128400 [Gossypium raimondii] gi|763782540|gb|KJB49611.1| hypothetical protein B456_008G128400 [Gossypium raimondii] Length = 456 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 314 RLCRHPVFQLSRPTKKRASLGTVNTRERGGEAW 216 RLCRHP+FQLS+PTKK +LG VNTR RGGEAW Sbjct: 423 RLCRHPIFQLSKPTKKTRNLGIVNTRGRGGEAW 455 >gb|KHG26369.1| Rho GTPase-activating gacA [Gossypium arboreum] Length = 464 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 314 RLCRHPVFQLSRPTKKRASLGTVNTRERGGEAW 216 RLCRHP+FQLS+PTKK +LG VNTR RGGEAW Sbjct: 431 RLCRHPIFQLSKPTKKTRNLGIVNTRGRGGEAW 463 >ref|XP_014491629.1| PREDICTED: rho GTPase-activating protein 3-like [Vigna radiata var. radiata] Length = 506 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 314 RLCRHPVFQLSRPTKKRASLGTVNTRERGGEAW 216 RLCRHPVF+LS+PTKK S+G VNTRE GG+AW Sbjct: 473 RLCRHPVFKLSKPTKKSESVGIVNTREEGGKAW 505 >gb|KOM53006.1| hypothetical protein LR48_Vigan09g166500 [Vigna angularis] Length = 505 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 314 RLCRHPVFQLSRPTKKRASLGTVNTRERGGEAW 216 RLCRHPVF+LS+PTKK S+G VNTRE GG+AW Sbjct: 472 RLCRHPVFKLSKPTKKSESVGIVNTREEGGKAW 504 >ref|XP_004510628.1| PREDICTED: rho GTPase-activating protein 5 [Cicer arietinum] Length = 493 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Frame = -3 Query: 314 RLCRHPVFQLSRPTKKRASLGTVNTRER-GGEAW 216 +LCRHPVFQLS+P+KK ASLG VNTRE GGEAW Sbjct: 459 KLCRHPVFQLSKPSKKNASLGIVNTREEGGGEAW 492 >ref|XP_007051458.1| Rho GTPase activating protein with PAK-box/P21-Rho-binding domain [Theobroma cacao] gi|508703719|gb|EOX95615.1| Rho GTPase activating protein with PAK-box/P21-Rho-binding domain [Theobroma cacao] Length = 497 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -3 Query: 314 RLCRHPVFQLSRPTKKRASLGTVNTRERGGEAWA 213 RLCRHPVFQLS+ TKK +LG VNTR GGEAWA Sbjct: 464 RLCRHPVFQLSKSTKKTRNLGIVNTRGGGGEAWA 497 >ref|XP_011038985.1| PREDICTED: rho GTPase-activating protein 3-like isoform X1 [Populus euphratica] Length = 489 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -3 Query: 314 RLCRHPVFQLSRPTKKRASLGTVNTRERGGEAWA 213 RLC HPVFQLS+P KK +G VNTR RGGEAWA Sbjct: 456 RLCIHPVFQLSKPVKKTRGIGIVNTRGRGGEAWA 489 >ref|XP_002320221.1| hypothetical protein POPTR_0014s09940g [Populus trichocarpa] gi|222860994|gb|EEE98536.1| hypothetical protein POPTR_0014s09940g [Populus trichocarpa] Length = 490 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -3 Query: 314 RLCRHPVFQLSRPTKKRASLGTVNTRERGGEAWA 213 RLC HPVFQLS+P KK +G VNTR RGGEAWA Sbjct: 457 RLCIHPVFQLSKPVKKTRGIGIVNTRGRGGEAWA 490 >ref|XP_010100679.1| Rho GTPase-activating protein gacA [Morus notabilis] gi|587895340|gb|EXB83841.1| Rho GTPase-activating protein gacA [Morus notabilis] Length = 520 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 2/36 (5%) Frame = -3 Query: 314 RLCRHPVFQLSRPTKKRASLGTV--NTRERGGEAWA 213 +LCRHPVFQL++P KK A+LG V NTRERGG AWA Sbjct: 485 KLCRHPVFQLNKPAKKTATLGIVNSNTRERGGAAWA 520