BLASTX nr result
ID: Wisteria21_contig00034198
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00034198 (359 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004492340.1| PREDICTED: pentatricopeptide repeat-containi... 121 2e-25 ref|XP_003623067.2| PPR containing plant-like protein, putative ... 102 1e-19 ref|XP_014517015.1| PREDICTED: pentatricopeptide repeat-containi... 78 2e-12 gb|KOM37994.1| hypothetical protein LR48_Vigan03g137600 [Vigna a... 78 2e-12 ref|XP_008232205.1| PREDICTED: pentatricopeptide repeat-containi... 77 4e-12 ref|XP_007140308.1| hypothetical protein PHAVU_008G101200g [Phas... 77 7e-12 ref|XP_009801005.1| PREDICTED: pentatricopeptide repeat-containi... 76 9e-12 ref|XP_009600385.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 gb|KRG99921.1| hypothetical protein GLYMA_18G1802002, partial [G... 73 7e-11 ref|XP_007220019.1| hypothetical protein PRUPE_ppa003879mg [Prun... 73 1e-10 ref|XP_006583587.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_012083143.1| PREDICTED: pentatricopeptide repeat-containi... 71 4e-10 ref|XP_002523294.1| pentatricopeptide repeat-containing protein,... 70 5e-10 ref|XP_011469560.1| PREDICTED: pentatricopeptide repeat-containi... 70 6e-10 ref|XP_010679259.1| PREDICTED: pentatricopeptide repeat-containi... 70 8e-10 ref|XP_010108947.1| hypothetical protein L484_027142 [Morus nota... 69 2e-09 emb|CDP11808.1| unnamed protein product [Coffea canephora] 68 3e-09 ref|XP_008345046.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_009376298.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 ref|XP_008450076.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 >ref|XP_004492340.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Cicer arietinum] Length = 545 Score = 121 bits (304), Expect = 2e-25 Identities = 56/87 (64%), Positives = 66/87 (75%) Frame = -1 Query: 266 MLCPRRNLSAQYHPIPFSTXXXXXXXXXXXXAPSLPESYVVQPPIKPWPHRLHPKLLASL 87 M P+ L AQ++ +PFST APSLPE+Y +QPPIKPWPHRL+PKLL+SL Sbjct: 1 MFSPKHILPAQHNLLPFSTAISAAITANTSSAPSLPENYQIQPPIKPWPHRLNPKLLSSL 60 Query: 86 ISRQHDPDLSLQIFHHAEHHHRPTFSH 6 ISRQHDP +SLQIFHHA+HHHRP FSH Sbjct: 61 ISRQHDPIVSLQIFHHAQHHHRPPFSH 87 >ref|XP_003623067.2| PPR containing plant-like protein, putative [Medicago truncatula] gi|657378065|gb|AES79285.2| PPR containing plant-like protein, putative [Medicago truncatula] Length = 535 Score = 102 bits (254), Expect = 1e-19 Identities = 47/75 (62%), Positives = 54/75 (72%) Frame = -1 Query: 230 HPIPFSTXXXXXXXXXXXXAPSLPESYVVQPPIKPWPHRLHPKLLASLISRQHDPDLSLQ 51 H FST PSLP+SY +QPPIKPWPHRL+PKLL+SLISRQHDP SLQ Sbjct: 8 HHHRFSTAISAAIVANTTTTPSLPQSYKIQPPIKPWPHRLNPKLLSSLISRQHDPHFSLQ 67 Query: 50 IFHHAEHHHRPTFSH 6 IF HA++HH+P FSH Sbjct: 68 IFLHAQNHHKPPFSH 82 >ref|XP_014517015.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Vigna radiata var. radiata] gi|951037854|ref|XP_014517016.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Vigna radiata var. radiata] Length = 534 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/56 (64%), Positives = 43/56 (76%) Frame = -1 Query: 170 PSLPESYVVQPPIKPWPHRLHPKLLASLISRQHDPDLSLQIFHHAEHHHRPTFSHT 3 P P S+ ++PP+ PWP RL P LASLISRQHDPDLSLQIF+HA+ H P+ SHT Sbjct: 34 PLPPSSFTIRPPVHPWPRRLTPLNLASLISRQHDPDLSLQIFYHAQSLH-PSLSHT 88 >gb|KOM37994.1| hypothetical protein LR48_Vigan03g137600 [Vigna angularis] Length = 534 Score = 78.2 bits (191), Expect = 2e-12 Identities = 35/55 (63%), Positives = 42/55 (76%) Frame = -1 Query: 170 PSLPESYVVQPPIKPWPHRLHPKLLASLISRQHDPDLSLQIFHHAEHHHRPTFSH 6 P P S+ ++PP+ PWP RL P LASLISRQHDPDLSLQ+FHHA+ H P+ SH Sbjct: 34 PLPPSSFTIRPPVHPWPRRLTPLNLASLISRQHDPDLSLQVFHHAQSLH-PSLSH 87 >ref|XP_008232205.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Prunus mume] gi|645252618|ref|XP_008232206.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Prunus mume] Length = 564 Score = 77.4 bits (189), Expect = 4e-12 Identities = 48/111 (43%), Positives = 60/111 (54%), Gaps = 7/111 (6%) Frame = -1 Query: 317 HEAKPG*RTIPLLSLSTMLCPRRNLSAQYHP-------IPFSTXXXXXXXXXXXXAPSLP 159 H G +P+ + STML R +SA+ P + FST L Sbjct: 6 HRRLGGHLPMPVFNSSTMLMLRLKISAKVCPHLHSITTVSFSTSASASPSISTV---DLL 62 Query: 158 ESYVVQPPIKPWPHRLHPKLLASLISRQHDPDLSLQIFHHAEHHHRPTFSH 6 +SY V PPI+PWP RLHPK L SLI+R+ + DL+LQIFHHA H P FSH Sbjct: 63 DSYTVTPPIQPWPRRLHPKRLISLITREPNLDLALQIFHHASKFH-PGFSH 112 >ref|XP_007140308.1| hypothetical protein PHAVU_008G101200g [Phaseolus vulgaris] gi|561013441|gb|ESW12302.1| hypothetical protein PHAVU_008G101200g [Phaseolus vulgaris] Length = 534 Score = 76.6 bits (187), Expect = 7e-12 Identities = 34/52 (65%), Positives = 41/52 (78%) Frame = -1 Query: 161 PESYVVQPPIKPWPHRLHPKLLASLISRQHDPDLSLQIFHHAEHHHRPTFSH 6 P S+ ++PP+ PWP RL P L+SLISRQHDPDLSLQIFHHA+ H P+ SH Sbjct: 37 PSSFKIRPPVHPWPRRLTPNNLSSLISRQHDPDLSLQIFHHAQSLH-PSISH 87 >ref|XP_009801005.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Nicotiana sylvestris] gi|698511904|ref|XP_009801006.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Nicotiana sylvestris] gi|698511906|ref|XP_009801007.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Nicotiana sylvestris] gi|698511908|ref|XP_009801008.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Nicotiana sylvestris] Length = 561 Score = 76.3 bits (186), Expect = 9e-12 Identities = 39/72 (54%), Positives = 42/72 (58%) Frame = -1 Query: 221 PFSTXXXXXXXXXXXXAPSLPESYVVQPPIKPWPHRLHPKLLASLISRQHDPDLSLQIFH 42 PF T L +SY V PPIKPWP L PK L SLI QHDP+LSLQIFH Sbjct: 41 PFKTHPSYQHLSTIKSKSELLQSYTVTPPIKPWPRYLSPKALISLIKSQHDPNLSLQIFH 100 Query: 41 HAEHHHRPTFSH 6 HA + H P FSH Sbjct: 101 HAGNFH-PGFSH 111 >ref|XP_009600385.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Nicotiana tomentosiformis] gi|697182748|ref|XP_009600386.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Nicotiana tomentosiformis] gi|697182750|ref|XP_009600388.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Nicotiana tomentosiformis] gi|697182752|ref|XP_009600389.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Nicotiana tomentosiformis] Length = 561 Score = 74.3 bits (181), Expect = 3e-11 Identities = 38/72 (52%), Positives = 41/72 (56%) Frame = -1 Query: 221 PFSTXXXXXXXXXXXXAPSLPESYVVQPPIKPWPHRLHPKLLASLISRQHDPDLSLQIFH 42 PF T L SY V PPIKPWP L PK L +LI QHDP+LSLQIFH Sbjct: 41 PFKTHPSYQHLSTIKSKSELLRSYTVTPPIKPWPRYLSPKTLITLIKSQHDPNLSLQIFH 100 Query: 41 HAEHHHRPTFSH 6 HA + H P FSH Sbjct: 101 HAGNFH-PGFSH 111 >gb|KRG99921.1| hypothetical protein GLYMA_18G1802002, partial [Glycine max] Length = 356 Score = 73.2 bits (178), Expect = 7e-11 Identities = 37/55 (67%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = -1 Query: 167 SLPES-YVVQPPIKPWPHRLHPKLLASLISRQHDPDLSLQIFHHAEHHHRPTFSH 6 SLP S + +QPPI PWP RL P LASLISRQHDP+LSLQIFHHA P+ SH Sbjct: 35 SLPSSSFTIQPPIHPWPRRLTPHNLASLISRQHDPNLSLQIFHHA----HPSLSH 85 >ref|XP_007220019.1| hypothetical protein PRUPE_ppa003879mg [Prunus persica] gi|462416481|gb|EMJ21218.1| hypothetical protein PRUPE_ppa003879mg [Prunus persica] Length = 542 Score = 72.8 bits (177), Expect = 1e-10 Identities = 35/53 (66%), Positives = 40/53 (75%) Frame = -1 Query: 164 LPESYVVQPPIKPWPHRLHPKLLASLISRQHDPDLSLQIFHHAEHHHRPTFSH 6 L +SY V PPI+PWP RLHPK L SLI+RQ + DL+LQIFHHA H P FSH Sbjct: 39 LLDSYTVTPPIEPWPRRLHPKRLISLITRQPNLDLALQIFHHASKFH-PGFSH 90 >ref|XP_006583587.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like isoform X1 [Glycine max] gi|571466177|ref|XP_006583588.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like isoform X2 [Glycine max] gi|947100600|gb|KRH49092.1| hypothetical protein GLYMA_07G131700 [Glycine max] Length = 529 Score = 72.4 bits (176), Expect = 1e-10 Identities = 35/50 (70%), Positives = 38/50 (76%) Frame = -1 Query: 155 SYVVQPPIKPWPHRLHPKLLASLISRQHDPDLSLQIFHHAEHHHRPTFSH 6 S+ +QPPI PWP RL P LASLISRQHDPDLSLQIFHHA P+ SH Sbjct: 40 SFRIQPPIYPWPRRLTPHNLASLISRQHDPDLSLQIFHHA----HPSLSH 85 >ref|XP_012083143.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Jatropha curcas] Length = 540 Score = 70.9 bits (172), Expect = 4e-10 Identities = 34/53 (64%), Positives = 40/53 (75%) Frame = -1 Query: 164 LPESYVVQPPIKPWPHRLHPKLLASLISRQHDPDLSLQIFHHAEHHHRPTFSH 6 LPESY V PPIKPWP RL+PK L S+I RQ + DL+LQIF +A +H P FSH Sbjct: 33 LPESYTVTPPIKPWPQRLYPKRLVSMIIRQQNLDLALQIFDYAGKYH-PGFSH 84 >ref|XP_002523294.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223537382|gb|EEF39010.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 544 Score = 70.5 bits (171), Expect = 5e-10 Identities = 33/53 (62%), Positives = 41/53 (77%) Frame = -1 Query: 164 LPESYVVQPPIKPWPHRLHPKLLASLISRQHDPDLSLQIFHHAEHHHRPTFSH 6 LPESY V PPIKPWP RL+PK L S+I+RQ + DL+LQIF +A ++P FSH Sbjct: 42 LPESYTVTPPIKPWPQRLYPKRLVSMITRQQNLDLALQIFEYA-GKYQPNFSH 93 >ref|XP_011469560.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Fragaria vesca subsp. vesca] gi|764630670|ref|XP_004308728.2| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Fragaria vesca subsp. vesca] Length = 526 Score = 70.1 bits (170), Expect = 6e-10 Identities = 42/87 (48%), Positives = 48/87 (55%) Frame = -1 Query: 266 MLCPRRNLSAQYHPIPFSTXXXXXXXXXXXXAPSLPESYVVQPPIKPWPHRLHPKLLASL 87 ML RR+LS P PFS S SY V PPI WPH LHPK L SL Sbjct: 1 MLLLRRSLS----PKPFSVSITAVPF-------SSSSSYTVTPPIPNWPHHLHPKRLISL 49 Query: 86 ISRQHDPDLSLQIFHHAEHHHRPTFSH 6 I+R+ + DL+L+IFHHA HH P F H Sbjct: 50 ITREPNLDLALRIFHHASQHH-PGFRH 75 >ref|XP_010679259.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Beta vulgaris subsp. vulgaris] gi|870868872|gb|KMT19668.1| hypothetical protein BVRB_1g010540 [Beta vulgaris subsp. vulgaris] Length = 548 Score = 69.7 bits (169), Expect = 8e-10 Identities = 34/55 (61%), Positives = 39/55 (70%) Frame = -1 Query: 167 SLPESYVVQPPIKPWPHRLHPKLLASLISRQHDPDLSLQIFHHAEHHHRPTFSHT 3 SLP SY V PPIKPWP L PK L ++I+RQ + DL+LQIFH A H P FSHT Sbjct: 44 SLPNSYKVTPPIKPWPKHLSPKRLITIITRQQNLDLALQIFHFAGKFH-PNFSHT 97 >ref|XP_010108947.1| hypothetical protein L484_027142 [Morus notabilis] gi|587933624|gb|EXC20587.1| hypothetical protein L484_027142 [Morus notabilis] Length = 531 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/51 (62%), Positives = 38/51 (74%) Frame = -1 Query: 158 ESYVVQPPIKPWPHRLHPKLLASLISRQHDPDLSLQIFHHAEHHHRPTFSH 6 ESY V PPIKPWP RL+PK L S+++RQ + DL+LQIF HA H P FSH Sbjct: 34 ESYTVTPPIKPWPQRLYPKRLVSILTRQQNLDLALQIFRHAGDFH-PGFSH 83 >emb|CDP11808.1| unnamed protein product [Coffea canephora] Length = 546 Score = 67.8 bits (164), Expect = 3e-09 Identities = 33/53 (62%), Positives = 38/53 (71%) Frame = -1 Query: 164 LPESYVVQPPIKPWPHRLHPKLLASLISRQHDPDLSLQIFHHAEHHHRPTFSH 6 L +SY + PPI PWP L K L SLISRQHD +L+LQIFHHA +H P FSH Sbjct: 70 LLQSYTITPPINPWPKDLSHKRLISLISRQHDLNLALQIFHHAGKYH-PKFSH 121 >ref|XP_008345046.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Malus domestica] Length = 544 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/50 (64%), Positives = 37/50 (74%) Frame = -1 Query: 155 SYVVQPPIKPWPHRLHPKLLASLISRQHDPDLSLQIFHHAEHHHRPTFSH 6 SY V PPI+PWP RL+PK L SLI+ Q + DL+LQIFHHA H P FSH Sbjct: 44 SYTVTPPIQPWPRRLYPKXLISLIAHQPNLDLALQIFHHASKFH-PGFSH 92 >ref|XP_009376298.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Pyrus x bretschneideri] Length = 542 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/50 (64%), Positives = 37/50 (74%) Frame = -1 Query: 155 SYVVQPPIKPWPHRLHPKLLASLISRQHDPDLSLQIFHHAEHHHRPTFSH 6 SY V PPI+PWP RL+PK L SLI+ Q + DL+LQIFHHA H P FSH Sbjct: 42 SYTVTPPIQPWPRRLYPKRLISLIAHQPNLDLALQIFHHASKFH-PGFSH 90 >ref|XP_008450076.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Cucumis melo] gi|659098313|ref|XP_008450077.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Cucumis melo] Length = 535 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = -1 Query: 158 ESYVVQPPIKPWPHRLHPKLLASLISRQHDPDLSLQIFHHAEHHHRPTFSH 6 +SY V PPIKPWP RL PK L ++I RQ + DL+LQIFH+A H P FSH Sbjct: 35 QSYTVTPPIKPWPQRLFPKRLVAMIRRQQNLDLALQIFHYAGKFH-PAFSH 84