BLASTX nr result
ID: Wisteria21_contig00032994
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00032994 (256 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003609454.2| ubiquitin carboxyl-terminal hydrolase [Medic... 116 6e-24 ref|XP_007155074.1| hypothetical protein PHAVU_003G171000g [Phas... 116 6e-24 ref|XP_014510289.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 114 2e-23 ref|XP_004508434.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 111 2e-22 ref|XP_003549730.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 111 2e-22 ref|XP_003542653.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 109 7e-22 gb|KOM32976.1| hypothetical protein LR48_Vigan01g253200 [Vigna a... 109 9e-22 ref|XP_012081166.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 91 4e-16 ref|XP_008242874.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 90 6e-16 ref|XP_008242873.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 90 6e-16 ref|XP_011017868.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 89 1e-15 ref|XP_007203762.1| hypothetical protein PRUPE_ppa003162mg [Prun... 88 2e-15 ref|XP_006389427.1| hypothetical protein POPTR_0025s00610g [Popu... 87 5e-15 ref|XP_008336963.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 87 6e-15 ref|XP_008336962.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 87 6e-15 ref|XP_008354354.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 86 1e-14 ref|XP_008354353.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 86 1e-14 ref|XP_002530760.1| Ubiquitin carboxyl-terminal hydrolase, putat... 85 2e-14 gb|KHG06131.1| Ubiquitin carboxyl-terminal hydrolase 22 -like pr... 85 2e-14 ref|XP_006453110.1| hypothetical protein CICLE_v10007858mg [Citr... 83 9e-14 >ref|XP_003609454.2| ubiquitin carboxyl-terminal hydrolase [Medicago truncatula] gi|657390694|gb|AES91651.2| ubiquitin carboxyl-terminal hydrolase [Medicago truncatula] Length = 594 Score = 116 bits (291), Expect = 6e-24 Identities = 51/55 (92%), Positives = 53/55 (96%) Frame = -3 Query: 254 CPHLAEFRRTSTKPFLALHNCLRIKPPGGRASLRRDPHEVPRCGACGLSAPSRLY 90 CPHLAEFRRTSTKPFL+LHNCLRIKPPGGRASLRRDPHE+P C ACGLSAPSRLY Sbjct: 14 CPHLAEFRRTSTKPFLSLHNCLRIKPPGGRASLRRDPHEIPHCNACGLSAPSRLY 68 >ref|XP_007155074.1| hypothetical protein PHAVU_003G171000g [Phaseolus vulgaris] gi|561028428|gb|ESW27068.1| hypothetical protein PHAVU_003G171000g [Phaseolus vulgaris] Length = 592 Score = 116 bits (291), Expect = 6e-24 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = -3 Query: 254 CPHLAEFRRTSTKPFLALHNCLRIKPPGGRASLRRDPHEVPRCGACGLSAPSRLY 90 CPHLAEFRRTSTKPFLALHNCLRIKPPGGRA+LRRDP EVPRCGACGLS+PSRLY Sbjct: 14 CPHLAEFRRTSTKPFLALHNCLRIKPPGGRAALRRDPDEVPRCGACGLSSPSRLY 68 >ref|XP_014510289.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like [Vigna radiata var. radiata] Length = 592 Score = 114 bits (286), Expect = 2e-23 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = -3 Query: 254 CPHLAEFRRTSTKPFLALHNCLRIKPPGGRASLRRDPHEVPRCGACGLSAPSRLY 90 CPHLAEFRRTSTKPFLALH+CLRIKPPGGRA+LRRDP EVPRCGACGLS+PSRLY Sbjct: 14 CPHLAEFRRTSTKPFLALHSCLRIKPPGGRAALRRDPDEVPRCGACGLSSPSRLY 68 >ref|XP_004508434.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like [Cicer arietinum] Length = 605 Score = 111 bits (278), Expect = 2e-22 Identities = 49/55 (89%), Positives = 52/55 (94%) Frame = -3 Query: 254 CPHLAEFRRTSTKPFLALHNCLRIKPPGGRASLRRDPHEVPRCGACGLSAPSRLY 90 CPHLAEFR TS+KPFL+LHNCLRIKPPGGRASLRRDPHE+P C ACGLSAPSRLY Sbjct: 33 CPHLAEFRLTSSKPFLSLHNCLRIKPPGGRASLRRDPHELPHCSACGLSAPSRLY 87 >ref|XP_003549730.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like [Glycine max] gi|947054162|gb|KRH03615.1| hypothetical protein GLYMA_17G109100 [Glycine max] Length = 592 Score = 111 bits (277), Expect = 2e-22 Identities = 50/55 (90%), Positives = 52/55 (94%) Frame = -3 Query: 254 CPHLAEFRRTSTKPFLALHNCLRIKPPGGRASLRRDPHEVPRCGACGLSAPSRLY 90 CPHLAEFRRTS KPFLALHNCLRIKPPGGRA+LRRDP EVPRC +CGLSAPSRLY Sbjct: 14 CPHLAEFRRTSAKPFLALHNCLRIKPPGGRAALRRDPDEVPRCCSCGLSAPSRLY 68 >ref|XP_003542653.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like [Glycine max] gi|947071300|gb|KRH20191.1| hypothetical protein GLYMA_13G162300 [Glycine max] Length = 594 Score = 109 bits (273), Expect = 7e-22 Identities = 50/55 (90%), Positives = 51/55 (92%) Frame = -3 Query: 254 CPHLAEFRRTSTKPFLALHNCLRIKPPGGRASLRRDPHEVPRCGACGLSAPSRLY 90 CPHLAEF RTS KPFLALHNCLRIKPPGGRASLRR+P EVPRC ACGLSAPSRLY Sbjct: 14 CPHLAEFHRTSAKPFLALHNCLRIKPPGGRASLRRNPDEVPRCCACGLSAPSRLY 68 >gb|KOM32976.1| hypothetical protein LR48_Vigan01g253200 [Vigna angularis] Length = 595 Score = 109 bits (272), Expect = 9e-22 Identities = 51/58 (87%), Positives = 54/58 (93%), Gaps = 3/58 (5%) Frame = -3 Query: 254 CPHLAEFRRTSTKPFLALHNCLRIKPPGGRASLRRDPHEVPR---CGACGLSAPSRLY 90 CPHLAEFRRTSTKPFLALH+CLRIKPPGGRA+LRRDP EVPR CGACGLS+PSRLY Sbjct: 14 CPHLAEFRRTSTKPFLALHSCLRIKPPGGRAALRRDPDEVPRCGACGACGLSSPSRLY 71 >ref|XP_012081166.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like [Jatropha curcas] gi|643719358|gb|KDP30228.1| hypothetical protein JCGZ_17010 [Jatropha curcas] Length = 594 Score = 90.5 bits (223), Expect = 4e-16 Identities = 41/56 (73%), Positives = 47/56 (83%), Gaps = 1/56 (1%) Frame = -3 Query: 254 CPHLAEFR-RTSTKPFLALHNCLRIKPPGGRASLRRDPHEVPRCGACGLSAPSRLY 90 CPHLAEFR R +KPF AL +CLR+KPPGGRA++RRDP EVPRCGACG S+ RLY Sbjct: 25 CPHLAEFRARNGSKPFRALQDCLRVKPPGGRAAIRRDPSEVPRCGACGESSRPRLY 80 >ref|XP_008242874.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like isoform X2 [Prunus mume] Length = 343 Score = 90.1 bits (222), Expect = 6e-16 Identities = 41/56 (73%), Positives = 47/56 (83%), Gaps = 1/56 (1%) Frame = -3 Query: 254 CPHLAEFR-RTSTKPFLALHNCLRIKPPGGRASLRRDPHEVPRCGACGLSAPSRLY 90 CPHLAEFR + +KPF AL +CLR+KPPGGRAS+RRDP E+PRCGACG SA RLY Sbjct: 23 CPHLAEFRAKNGSKPFRALQDCLRVKPPGGRASIRRDPKELPRCGACGESACPRLY 78 >ref|XP_008242873.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like isoform X1 [Prunus mume] Length = 597 Score = 90.1 bits (222), Expect = 6e-16 Identities = 41/56 (73%), Positives = 47/56 (83%), Gaps = 1/56 (1%) Frame = -3 Query: 254 CPHLAEFR-RTSTKPFLALHNCLRIKPPGGRASLRRDPHEVPRCGACGLSAPSRLY 90 CPHLAEFR + +KPF AL +CLR+KPPGGRAS+RRDP E+PRCGACG SA RLY Sbjct: 23 CPHLAEFRAKNGSKPFRALQDCLRVKPPGGRASIRRDPKELPRCGACGESACPRLY 78 >ref|XP_011017868.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like [Populus euphratica] Length = 586 Score = 89.4 bits (220), Expect = 1e-15 Identities = 40/56 (71%), Positives = 46/56 (82%), Gaps = 1/56 (1%) Frame = -3 Query: 254 CPHLAEFR-RTSTKPFLALHNCLRIKPPGGRASLRRDPHEVPRCGACGLSAPSRLY 90 CPHLA+FR R TKPF L NCLRIKPP GRAS+RRDP E+PRCGACG+S+ R+Y Sbjct: 21 CPHLADFRSRNGTKPFHLLQNCLRIKPPHGRASIRRDPSEIPRCGACGVSSVPRIY 76 >ref|XP_007203762.1| hypothetical protein PRUPE_ppa003162mg [Prunus persica] gi|462399293|gb|EMJ04961.1| hypothetical protein PRUPE_ppa003162mg [Prunus persica] Length = 597 Score = 88.2 bits (217), Expect = 2e-15 Identities = 40/56 (71%), Positives = 46/56 (82%), Gaps = 1/56 (1%) Frame = -3 Query: 254 CPHLAEFR-RTSTKPFLALHNCLRIKPPGGRASLRRDPHEVPRCGACGLSAPSRLY 90 CPHLAEFR + +KPF AL +CLR+KPP GRAS+RRDP E+PRCGACG SA RLY Sbjct: 23 CPHLAEFRAKNGSKPFRALQDCLRVKPPSGRASIRRDPKELPRCGACGESARPRLY 78 >ref|XP_006389427.1| hypothetical protein POPTR_0025s00610g [Populus trichocarpa] gi|550312221|gb|ERP48341.1| hypothetical protein POPTR_0025s00610g [Populus trichocarpa] Length = 587 Score = 87.0 bits (214), Expect = 5e-15 Identities = 39/56 (69%), Positives = 45/56 (80%), Gaps = 1/56 (1%) Frame = -3 Query: 254 CPHLAEFR-RTSTKPFLALHNCLRIKPPGGRASLRRDPHEVPRCGACGLSAPSRLY 90 CPHLA+FR R TKPF L NCLRIKPP GRAS+RRDP E+PRCGAC +S+ R+Y Sbjct: 21 CPHLADFRSRNGTKPFHLLQNCLRIKPPHGRASIRRDPSEIPRCGACAVSSVPRIY 76 >ref|XP_008336963.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like isoform X2 [Malus domestica] Length = 408 Score = 86.7 bits (213), Expect = 6e-15 Identities = 40/56 (71%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = -3 Query: 254 CPHLAEF-RRTSTKPFLALHNCLRIKPPGGRASLRRDPHEVPRCGACGLSAPSRLY 90 CPHLAEF +KPF AL +CLR+KPPGGRAS+RRDP EVPRCGACG S RLY Sbjct: 50 CPHLAEFLSNNGSKPFRALQDCLRVKPPGGRASIRRDPKEVPRCGACGESERPRLY 105 >ref|XP_008336962.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like isoform X1 [Malus domestica] Length = 624 Score = 86.7 bits (213), Expect = 6e-15 Identities = 40/56 (71%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = -3 Query: 254 CPHLAEF-RRTSTKPFLALHNCLRIKPPGGRASLRRDPHEVPRCGACGLSAPSRLY 90 CPHLAEF +KPF AL +CLR+KPPGGRAS+RRDP EVPRCGACG S RLY Sbjct: 50 CPHLAEFLSNNGSKPFRALQDCLRVKPPGGRASIRRDPKEVPRCGACGESERPRLY 105 >ref|XP_008354354.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like isoform X2 [Malus domestica] Length = 409 Score = 85.9 bits (211), Expect = 1e-14 Identities = 40/56 (71%), Positives = 45/56 (80%), Gaps = 1/56 (1%) Frame = -3 Query: 254 CPHLAEFRRTS-TKPFLALHNCLRIKPPGGRASLRRDPHEVPRCGACGLSAPSRLY 90 CPHL EF + +KPF AL +CLR+KPPGGRAS+RRDP EVPRCGACG SA RLY Sbjct: 23 CPHLIEFLSBNXSKPFRALQDCLRVKPPGGRASIRRDPKEVPRCGACGESARPRLY 78 >ref|XP_008354353.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like isoform X1 [Malus domestica] Length = 597 Score = 85.9 bits (211), Expect = 1e-14 Identities = 40/56 (71%), Positives = 45/56 (80%), Gaps = 1/56 (1%) Frame = -3 Query: 254 CPHLAEFRRTS-TKPFLALHNCLRIKPPGGRASLRRDPHEVPRCGACGLSAPSRLY 90 CPHL EF + +KPF AL +CLR+KPPGGRAS+RRDP EVPRCGACG SA RLY Sbjct: 23 CPHLIEFLSBNXSKPFRALQDCLRVKPPGGRASIRRDPKEVPRCGACGESARPRLY 78 >ref|XP_002530760.1| Ubiquitin carboxyl-terminal hydrolase, putative [Ricinus communis] gi|223529676|gb|EEF31620.1| Ubiquitin carboxyl-terminal hydrolase, putative [Ricinus communis] Length = 577 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/56 (69%), Positives = 45/56 (80%), Gaps = 1/56 (1%) Frame = -3 Query: 254 CPHLAEFR-RTSTKPFLALHNCLRIKPPGGRASLRRDPHEVPRCGACGLSAPSRLY 90 CPHLAEF R +KPF L +CLRIKPPGGRA++RR+P EVPRCGACG S+ RLY Sbjct: 13 CPHLAEFHSRNGSKPFRFLQDCLRIKPPGGRAAIRREPSEVPRCGACGESSRPRLY 68 >gb|KHG06131.1| Ubiquitin carboxyl-terminal hydrolase 22 -like protein [Gossypium arboreum] Length = 634 Score = 84.7 bits (208), Expect = 2e-14 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 1/56 (1%) Frame = -3 Query: 254 CPHLAEFR-RTSTKPFLALHNCLRIKPPGGRASLRRDPHEVPRCGACGLSAPSRLY 90 CPHL +FR R KPF ALH+C+R+KPPGGRA++RR+P EVPRCG C S+ SRLY Sbjct: 14 CPHLLDFRFRNGPKPFRALHDCIRVKPPGGRAAIRREPSEVPRCGTCEESSRSRLY 69 >ref|XP_006453110.1| hypothetical protein CICLE_v10007858mg [Citrus clementina] gi|568840886|ref|XP_006474396.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like [Citrus sinensis] gi|557556336|gb|ESR66350.1| hypothetical protein CICLE_v10007858mg [Citrus clementina] Length = 572 Score = 82.8 bits (203), Expect = 9e-14 Identities = 38/56 (67%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = -3 Query: 254 CPHLAEFR-RTSTKPFLALHNCLRIKPPGGRASLRRDPHEVPRCGACGLSAPSRLY 90 CPHLA+FR R TKPF A+ +CL IKPPGGRA++RRDP EVPRC CG S+ RLY Sbjct: 23 CPHLADFRARNGTKPFRAIQDCLHIKPPGGRAAIRRDPSEVPRCVVCGDSSCPRLY 78