BLASTX nr result
ID: Wisteria21_contig00032767
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00032767 (237 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013452911.1| pentatricopeptide (PPR) repeat protein [Medi... 97 6e-18 ref|XP_003619749.2| pentatricopeptide (PPR) repeat protein [Medi... 91 4e-16 gb|KRH39074.1| hypothetical protein GLYMA_09G176600 [Glycine max] 90 6e-16 ref|XP_006587471.1| PREDICTED: putative pentatricopeptide repeat... 90 6e-16 ref|XP_013452872.1| pentatricopeptide (PPR) repeat protein [Medi... 89 1e-15 ref|XP_013452896.1| pentatricopeptide (PPR) repeat protein [Medi... 88 2e-15 ref|XP_013452894.1| RNA processing factor 2, putative [Medicago ... 88 2e-15 ref|XP_013452838.1| pentatricopeptide (PPR) repeat protein [Medi... 88 2e-15 ref|XP_003619770.2| pentatricopeptide (PPR) repeat protein [Medi... 88 2e-15 ref|XP_013452886.1| pentatricopeptide (PPR) repeat protein [Medi... 88 3e-15 ref|XP_003620129.2| pentatricopeptide (PPR) repeat protein [Medi... 88 3e-15 ref|XP_013452879.1| pentatricopeptide (PPR) repeat protein [Medi... 88 3e-15 ref|XP_013457840.1| pentatricopeptide (PPR) repeat protein [Medi... 87 4e-15 ref|XP_013452890.1| pentatricopeptide (PPR) repeat protein [Medi... 87 4e-15 ref|XP_003619813.1| pentatricopeptide (PPR) repeat protein [Medi... 87 5e-15 ref|XP_003619805.1| pentatricopeptide (PPR) repeat protein [Medi... 87 5e-15 ref|XP_013452880.1| pentatricopeptide (PPR) repeat protein [Medi... 87 6e-15 ref|XP_013452884.1| pentatricopeptide (PPR) repeat protein [Medi... 86 8e-15 gb|KRH39064.1| hypothetical protein GLYMA_09G175800 [Glycine max] 86 1e-14 gb|KRH39058.1| hypothetical protein GLYMA_09G175200 [Glycine max] 86 1e-14 >ref|XP_013452911.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657383187|gb|KEH26939.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 183 Score = 96.7 bits (239), Expect = 6e-18 Identities = 44/77 (57%), Positives = 61/77 (79%), Gaps = 1/77 (1%) Frame = -3 Query: 232 ITFNSLLDSWCEKQHAYKAIALI-KFKDQRVRPNMYIYALLIGVLCKGGRLDDAREIFQC 56 IT+NS+LD+ C++ H KAI L+ K KDQ ++PN+Y Y +LIG LCKGGRL+DAR++F+ Sbjct: 46 ITYNSILDALCKRHHLDKAITLLSKLKDQGIQPNIYTYTILIGGLCKGGRLEDARKVFEV 105 Query: 55 LLITGFNLDVLMYNVMI 5 +L+ G+NLDV Y VMI Sbjct: 106 ILVKGYNLDVYAYAVMI 122 >ref|XP_003619749.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657382782|gb|AES75967.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 557 Score = 90.5 bits (223), Expect = 4e-16 Identities = 46/78 (58%), Positives = 58/78 (74%), Gaps = 1/78 (1%) Frame = -3 Query: 232 ITFNSLLDSWCEKQHAYKAIAL-IKFKDQRVRPNMYIYALLIGVLCKGGRLDDAREIFQC 56 IT++S+LD+ C+ KAIAL IK KDQ +RPNMY Y +LI LCKGGRL+DAR IF+ Sbjct: 421 ITYSSILDALCKNHLVDKAIALLIKLKDQGIRPNMYTYTILIDGLCKGGRLEDARNIFED 480 Query: 55 LLITGFNLDVLMYNVMIR 2 LL+ G+NL V Y VMI+ Sbjct: 481 LLVKGYNLTVNTYTVMIQ 498 >gb|KRH39074.1| hypothetical protein GLYMA_09G176600 [Glycine max] Length = 497 Score = 90.1 bits (222), Expect = 6e-16 Identities = 44/77 (57%), Positives = 57/77 (74%), Gaps = 1/77 (1%) Frame = -3 Query: 232 ITFNSLLDSWCEKQHAYKAIALI-KFKDQRVRPNMYIYALLIGVLCKGGRLDDAREIFQC 56 IT+NSL+D C+ H KAIAL K KDQ +RPN + + +L+ LCKGGRL DA+E+FQ Sbjct: 361 ITYNSLIDGLCKNGHLDKAIALFNKMKDQGIRPNTFTFTILLDGLCKGGRLKDAQEVFQD 420 Query: 55 LLITGFNLDVLMYNVMI 5 LL G++LDV +YNVMI Sbjct: 421 LLTKGYHLDVYIYNVMI 437 >ref|XP_006587471.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial-like [Glycine max] Length = 546 Score = 90.1 bits (222), Expect = 6e-16 Identities = 44/77 (57%), Positives = 57/77 (74%), Gaps = 1/77 (1%) Frame = -3 Query: 232 ITFNSLLDSWCEKQHAYKAIALI-KFKDQRVRPNMYIYALLIGVLCKGGRLDDAREIFQC 56 IT+NSL+D C+ H KAIAL K KDQ +RPN + + +L+ LCKGGRL DA+E+FQ Sbjct: 410 ITYNSLIDGLCKNGHLDKAIALFNKMKDQGIRPNTFTFTILLDGLCKGGRLKDAQEVFQD 469 Query: 55 LLITGFNLDVLMYNVMI 5 LL G++LDV +YNVMI Sbjct: 470 LLTKGYHLDVYIYNVMI 486 >ref|XP_013452872.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657383145|gb|KEH26900.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 379 Score = 89.4 bits (220), Expect = 1e-15 Identities = 44/77 (57%), Positives = 56/77 (72%), Gaps = 1/77 (1%) Frame = -3 Query: 232 ITFNSLLDSWCEKQHAYKAIALI-KFKDQRVRPNMYIYALLIGVLCKGGRLDDAREIFQC 56 IT++S+LD+ C+ KAIAL+ K KDQ +RPNMY Y +LI LCKGGRLDDA IF+ Sbjct: 253 ITYSSILDALCKNHQVDKAIALLTKLKDQGIRPNMYTYTILIDGLCKGGRLDDAHNIFED 312 Query: 55 LLITGFNLDVLMYNVMI 5 LL+ G+N+ V Y VMI Sbjct: 313 LLVKGYNITVNTYTVMI 329 >ref|XP_013452896.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657383172|gb|KEH26924.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 409 Score = 88.2 bits (217), Expect = 2e-15 Identities = 44/77 (57%), Positives = 56/77 (72%), Gaps = 1/77 (1%) Frame = -3 Query: 232 ITFNSLLDSWCEKQHAYKAIALIK-FKDQRVRPNMYIYALLIGVLCKGGRLDDAREIFQC 56 IT+NSLLD+ C+ KAIAL+K KDQ ++PNMY Y +L+ LCK GRL DAREI+ Sbjct: 273 ITYNSLLDALCKNHQVDKAIALLKKMKDQGIQPNMYTYTILVDGLCKNGRLADAREIYHD 332 Query: 55 LLITGFNLDVLMYNVMI 5 LL G+ L+V MYNVM+ Sbjct: 333 LLTKGYPLNVSMYNVMV 349 >ref|XP_013452894.1| RNA processing factor 2, putative [Medicago truncatula] gi|657383170|gb|KEH26922.1| RNA processing factor 2, putative [Medicago truncatula] Length = 541 Score = 88.2 bits (217), Expect = 2e-15 Identities = 43/77 (55%), Positives = 57/77 (74%), Gaps = 1/77 (1%) Frame = -3 Query: 232 ITFNSLLDSWCEKQHAYKAIALIK-FKDQRVRPNMYIYALLIGVLCKGGRLDDAREIFQC 56 IT+NSLLD+ C+ KAIAL+K KDQ ++PNMY Y +L+ LCK GRL+DA+EI+ Sbjct: 405 ITYNSLLDALCKNHQVDKAIALLKKIKDQGIQPNMYTYTILVDGLCKNGRLEDAQEIYHD 464 Query: 55 LLITGFNLDVLMYNVMI 5 LL G+ L+V MYNVM+ Sbjct: 465 LLTKGYPLNVSMYNVMV 481 >ref|XP_013452838.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657383080|gb|KEH26866.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 403 Score = 88.2 bits (217), Expect = 2e-15 Identities = 43/77 (55%), Positives = 58/77 (75%), Gaps = 1/77 (1%) Frame = -3 Query: 232 ITFNSLLDSWCEKQHAYKAIALI-KFKDQRVRPNMYIYALLIGVLCKGGRLDDAREIFQC 56 IT++SLLD+ C+ H KAIAL+ K KDQ ++PNMY Y +LI LCKGGR +DA+ IF+ Sbjct: 267 ITYSSLLDALCKNHHVDKAIALLTKLKDQGLQPNMYTYTILINGLCKGGRPEDAQNIFED 326 Query: 55 LLITGFNLDVLMYNVMI 5 LL+ G+N++V Y VMI Sbjct: 327 LLVKGYNINVNTYTVMI 343 >ref|XP_003619770.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657382815|gb|AES75988.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 557 Score = 88.2 bits (217), Expect = 2e-15 Identities = 41/78 (52%), Positives = 59/78 (75%), Gaps = 1/78 (1%) Frame = -3 Query: 232 ITFNSLLDSWCEKQHAYKAIALI-KFKDQRVRPNMYIYALLIGVLCKGGRLDDAREIFQC 56 IT+NS+LD+ C+ H KAIAL+ KDQ +RP+MY Y +LI LC+ G+L+DA+++F+ Sbjct: 421 ITYNSILDALCKNHHVDKAIALLTNLKDQGIRPDMYTYTVLIKGLCQSGKLEDAQKVFED 480 Query: 55 LLITGFNLDVLMYNVMIR 2 LL+ G+NLDV Y VMI+ Sbjct: 481 LLVKGYNLDVYTYTVMIQ 498 >ref|XP_013452886.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657383162|gb|KEH26914.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 501 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/78 (52%), Positives = 59/78 (75%), Gaps = 1/78 (1%) Frame = -3 Query: 232 ITFNSLLDSWCEKQHAYKAIALI-KFKDQRVRPNMYIYALLIGVLCKGGRLDDAREIFQC 56 IT+NS+LD+ C+K H KAIAL+ K K Q +RP+M Y +L+ LC+ G+L+DAR++F+ Sbjct: 365 ITYNSILDALCKKHHVDKAIALLTKLKGQGIRPDMNTYTILVKGLCRSGKLEDARKVFED 424 Query: 55 LLITGFNLDVLMYNVMIR 2 LL+ G+NLDV Y VMI+ Sbjct: 425 LLVKGYNLDVYAYTVMIQ 442 >ref|XP_003620129.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657383157|gb|AES76347.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 570 Score = 87.8 bits (216), Expect = 3e-15 Identities = 43/77 (55%), Positives = 56/77 (72%), Gaps = 1/77 (1%) Frame = -3 Query: 232 ITFNSLLDSWCEKQHAYKAIALI-KFKDQRVRPNMYIYALLIGVLCKGGRLDDAREIFQC 56 IT++S+LD+ C+ KAIAL+ K KDQ +RPNMY Y +LI LCKGGRL+DA IF+ Sbjct: 435 ITYSSILDALCKNHQVDKAIALLTKLKDQGIRPNMYTYTILIDGLCKGGRLEDAHNIFED 494 Query: 55 LLITGFNLDVLMYNVMI 5 LL+ G+N+ V Y VMI Sbjct: 495 LLVKGYNITVNTYTVMI 511 >ref|XP_013452879.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657383154|gb|KEH26907.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 457 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/78 (52%), Positives = 59/78 (75%), Gaps = 1/78 (1%) Frame = -3 Query: 232 ITFNSLLDSWCEKQHAYKAIALI-KFKDQRVRPNMYIYALLIGVLCKGGRLDDAREIFQC 56 IT+NS+LD+ C+K H KAIAL+ K K Q +RP+M Y +L+ LC+ G+L+DAR++F+ Sbjct: 253 ITYNSILDALCKKHHVDKAIALLTKLKGQGIRPDMNTYTILVKGLCRSGKLEDARKVFED 312 Query: 55 LLITGFNLDVLMYNVMIR 2 LL+ G+NLDV Y VMI+ Sbjct: 313 LLVKGYNLDVYAYTVMIQ 330 >ref|XP_013457840.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657390323|gb|KEH31871.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 440 Score = 87.4 bits (215), Expect = 4e-15 Identities = 42/77 (54%), Positives = 57/77 (74%), Gaps = 1/77 (1%) Frame = -3 Query: 232 ITFNSLLDSWCEKQHAYKAIALI-KFKDQRVRPNMYIYALLIGVLCKGGRLDDAREIFQC 56 IT+NSLLD+ C+ KAI L+ K KDQ ++PNMY Y +L+ LCK GRL DA+ ++Q Sbjct: 304 ITYNSLLDALCKNHQVDKAITLLTKIKDQGIQPNMYTYTILVDGLCKNGRLKDAQVVYQN 363 Query: 55 LLITGFNLDVLMYNVMI 5 LLI G++LDV MY+VM+ Sbjct: 364 LLIKGYHLDVKMYSVMV 380 >ref|XP_013452890.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657383166|gb|KEH26918.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 544 Score = 87.4 bits (215), Expect = 4e-15 Identities = 42/78 (53%), Positives = 58/78 (74%), Gaps = 1/78 (1%) Frame = -3 Query: 232 ITFNSLLDSWCEKQHAYKAIALI-KFKDQRVRPNMYIYALLIGVLCKGGRLDDAREIFQC 56 +T+NS+LD+ C+ KAIAL+ KFKDQ ++P++Y Y +LI LCKGGRL DAR IF+ Sbjct: 408 VTYNSILDALCKTHQVDKAIALLTKFKDQGIQPSVYTYTILIDGLCKGGRLKDARNIFED 467 Query: 55 LLITGFNLDVLMYNVMIR 2 LL+ G+N+ V Y VMI+ Sbjct: 468 LLVKGYNITVNTYTVMIQ 485 >ref|XP_003619813.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|355494828|gb|AES76031.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 614 Score = 87.0 bits (214), Expect = 5e-15 Identities = 42/77 (54%), Positives = 57/77 (74%), Gaps = 1/77 (1%) Frame = -3 Query: 232 ITFNSLLDSWCEKQHAYKAIALI-KFKDQRVRPNMYIYALLIGVLCKGGRLDDAREIFQC 56 IT++SLLD+ C+ KAI LI K KDQ ++PN+Y Y +L+ LCK GRL DA+ ++Q Sbjct: 415 ITYSSLLDALCKNHQVDKAITLITKIKDQGIQPNIYTYTILVDGLCKNGRLKDAQAVYQD 474 Query: 55 LLITGFNLDVLMYNVMI 5 LLI G++LDV MYNVM+ Sbjct: 475 LLIKGYHLDVKMYNVMV 491 >ref|XP_003619805.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|355494820|gb|AES76023.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 548 Score = 87.0 bits (214), Expect = 5e-15 Identities = 40/78 (51%), Positives = 58/78 (74%), Gaps = 1/78 (1%) Frame = -3 Query: 232 ITFNSLLDSWCEKQHAYKAIALI-KFKDQRVRPNMYIYALLIGVLCKGGRLDDAREIFQC 56 +T++S+LD+ C+ H KAIAL+ KDQ +RP+MY Y +LI LC+ GRL+DA+ +F+ Sbjct: 412 VTYSSILDALCKNHHVDKAIALLTNLKDQGIRPDMYTYTILIKGLCQSGRLEDAQNVFED 471 Query: 55 LLITGFNLDVLMYNVMIR 2 LL+ G+NLDV Y VMI+ Sbjct: 472 LLVKGYNLDVYAYTVMIQ 489 >ref|XP_013452880.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657383155|gb|KEH26908.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 389 Score = 86.7 bits (213), Expect = 6e-15 Identities = 43/77 (55%), Positives = 55/77 (71%), Gaps = 1/77 (1%) Frame = -3 Query: 232 ITFNSLLDSWCEKQHAYKAIALI-KFKDQRVRPNMYIYALLIGVLCKGGRLDDAREIFQC 56 IT++SLLD+ C+ KAIAL+ KDQ +RPNMY Y +LI LCKGGRL+DA IF+ Sbjct: 253 ITYSSLLDALCKNHQVDKAIALLTNLKDQGIRPNMYTYTILIDGLCKGGRLEDAHNIFED 312 Query: 55 LLITGFNLDVLMYNVMI 5 LL+ G+N+ V Y VMI Sbjct: 313 LLVKGYNITVNTYTVMI 329 >ref|XP_013452884.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657383160|gb|KEH26912.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 276 Score = 86.3 bits (212), Expect = 8e-15 Identities = 43/78 (55%), Positives = 59/78 (75%), Gaps = 1/78 (1%) Frame = -3 Query: 232 ITFNSLLDSWCEKQHAYKAIALI-KFKDQRVRPNMYIYALLIGVLCKGGRLDDAREIFQC 56 IT+NS+LD+ C+K HA KAIAL+ K KDQ +RPNM Y +L+ LC+ G+L+DAR++F+ Sbjct: 143 ITYNSILDALCKKHHAGKAIALLTKLKDQGIRPNMNTYTILVKGLCRSGKLEDARKVFED 202 Query: 55 LLITGFNLDVLMYNVMIR 2 L G+NLDV Y VMI+ Sbjct: 203 L---GYNLDVYAYTVMIQ 217 >gb|KRH39064.1| hypothetical protein GLYMA_09G175800 [Glycine max] Length = 969 Score = 85.9 bits (211), Expect = 1e-14 Identities = 41/77 (53%), Positives = 57/77 (74%), Gaps = 1/77 (1%) Frame = -3 Query: 232 ITFNSLLDSWCEKQHAYKAIALI-KFKDQRVRPNMYIYALLIGVLCKGGRLDDAREIFQC 56 IT++SL+D C+ H +AIAL K KDQ +RPN++ + +L+ LCKGGRL DA+E+FQ Sbjct: 410 ITYSSLIDGLCKNGHLDRAIALFNKMKDQEIRPNIFTFTILLDGLCKGGRLKDAQEVFQD 469 Query: 55 LLITGFNLDVLMYNVMI 5 LL G++L+V YNVMI Sbjct: 470 LLTKGYHLNVYTYNVMI 486 >gb|KRH39058.1| hypothetical protein GLYMA_09G175200 [Glycine max] Length = 497 Score = 85.9 bits (211), Expect = 1e-14 Identities = 41/77 (53%), Positives = 57/77 (74%), Gaps = 1/77 (1%) Frame = -3 Query: 232 ITFNSLLDSWCEKQHAYKAIALI-KFKDQRVRPNMYIYALLIGVLCKGGRLDDAREIFQC 56 IT++SL+D C+ H +AIAL K KDQ +RPN++ + +L+ LCKGGRL DA+E+FQ Sbjct: 361 ITYSSLIDGLCKNGHLDRAIALFNKMKDQEIRPNIFTFTILLDGLCKGGRLKDAQEVFQD 420 Query: 55 LLITGFNLDVLMYNVMI 5 LL G++L+V YNVMI Sbjct: 421 LLTKGYHLNVYTYNVMI 437