BLASTX nr result
ID: Wisteria21_contig00032728
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00032728 (350 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004502787.1| PREDICTED: DNA-binding protein BIN4 [Cicer a... 60 8e-07 >ref|XP_004502787.1| PREDICTED: DNA-binding protein BIN4 [Cicer arietinum] Length = 434 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -2 Query: 100 PDWLRSFQVPTHSPLTLSSDSESLHDGGSSSGE 2 PDWLRSFQ PTHSP+TLSSDS SLHD GS S E Sbjct: 9 PDWLRSFQAPTHSPVTLSSDSGSLHDSGSFSDE 41