BLASTX nr result
ID: Wisteria21_contig00031742
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00031742 (517 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007135548.1| hypothetical protein PHAVU_010G138600g [Phas... 47 5e-07 >ref|XP_007135548.1| hypothetical protein PHAVU_010G138600g [Phaseolus vulgaris] gi|561008593|gb|ESW07542.1| hypothetical protein PHAVU_010G138600g [Phaseolus vulgaris] Length = 99 Score = 46.6 bits (109), Expect(2) = 5e-07 Identities = 18/33 (54%), Positives = 26/33 (78%) Frame = -2 Query: 429 NTGKQSAKGCLNTRGWTCGQKNNSIFLNCIKLP 331 N+GKQ GCLN G+T G+ NNS++++C+KLP Sbjct: 25 NSGKQRTLGCLNNSGFTGGKGNNSMYMSCVKLP 57 Score = 33.9 bits (76), Expect(2) = 5e-07 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -3 Query: 329 PEGLVLKVAFLKKRVLGCCKSSLCKPLCQSC--RSCGTCPCA 210 P G VL + +RV GC K+ L PL + C CG C CA Sbjct: 57 PGGSVLSFYCIGQRVWGCFKTCLSLPLPKCCITTCCGCCACA 98