BLASTX nr result
ID: Wisteria21_contig00031729
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00031729 (245 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004511531.1| PREDICTED: probable inactive receptor kinase... 68 2e-09 gb|AFK45382.1| unknown [Medicago truncatula] 64 3e-08 ref|XP_003611028.1| LRR receptor-like kinase [Medicago truncatul... 64 3e-08 ref|XP_007210296.1| hypothetical protein PRUPE_ppa002579mg [Prun... 56 9e-06 >ref|XP_004511531.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform X1 [Cicer arietinum] gi|828330104|ref|XP_012574374.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform X1 [Cicer arietinum] gi|828330109|ref|XP_012574375.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform X1 [Cicer arietinum] gi|828330111|ref|XP_012574376.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform X1 [Cicer arietinum] Length = 607 Score = 68.2 bits (165), Expect = 2e-09 Identities = 35/48 (72%), Positives = 40/48 (83%), Gaps = 1/48 (2%) Frame = -2 Query: 142 MGY-LPRIFLYSIYLVGLLFCQGNAEAVEDKQALLEFVKRFPPSRPLN 2 MGY L RIFLYS+YL+GL+ QGNAE VEDK+ALLEFVK+ P SR LN Sbjct: 1 MGYFLYRIFLYSVYLIGLIVFQGNAEPVEDKKALLEFVKKLPISRTLN 48 >gb|AFK45382.1| unknown [Medicago truncatula] Length = 610 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -2 Query: 136 YLPRIFLYSIYLVGLLFCQGNAEAVEDKQALLEFVKRFPPSRPLN 2 ++P IFL+S+YL+GLL GNAE EDK+ALLEFV++ PP +PLN Sbjct: 4 FVPNIFLFSVYLIGLLVYLGNAEPFEDKKALLEFVQKLPPFKPLN 48 >ref|XP_003611028.1| LRR receptor-like kinase [Medicago truncatula] gi|355512363|gb|AES93986.1| LRR receptor-like kinase [Medicago truncatula] Length = 610 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -2 Query: 136 YLPRIFLYSIYLVGLLFCQGNAEAVEDKQALLEFVKRFPPSRPLN 2 ++P IFL+S+YL+GLL GNAE EDK+ALLEFV++ PP +PLN Sbjct: 4 FVPNIFLFSVYLIGLLVYLGNAEPFEDKKALLEFVQKLPPFKPLN 48 >ref|XP_007210296.1| hypothetical protein PRUPE_ppa002579mg [Prunus persica] gi|462406031|gb|EMJ11495.1| hypothetical protein PRUPE_ppa002579mg [Prunus persica] Length = 656 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -2 Query: 127 RIFLYSIYLVGLLFCQGNAEAVEDKQALLEFVKRFPPSRPLN 2 R LY I+L+GL+F QGNA+ VEDKQALL+FV P SR LN Sbjct: 31 RCILYWIFLLGLVFLQGNADPVEDKQALLDFVNNLPHSRSLN 72