BLASTX nr result
ID: Wisteria21_contig00031302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00031302 (236 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004499434.1| PREDICTED: protein PXR1 [Cicer arietinum] 61 4e-07 ref|XP_003522342.1| PREDICTED: nucleolar protein 58-like [Glycin... 59 1e-06 ref|XP_013459377.1| hypothetical protein MTR_3g437860 [Medicago ... 59 2e-06 >ref|XP_004499434.1| PREDICTED: protein PXR1 [Cicer arietinum] Length = 105 Score = 60.8 bits (146), Expect = 4e-07 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -2 Query: 139 PVKLKQKLEKLDSKMQAMVAKREEILKQLKEVETNPSEAT 20 PV LKQKLEKLD KMQA+VAKREEILK L E+ETN SE + Sbjct: 66 PVILKQKLEKLDVKMQALVAKREEILKLLNEIETNSSEVS 105 >ref|XP_003522342.1| PREDICTED: nucleolar protein 58-like [Glycine max] gi|734338797|gb|KHN08858.1| hypothetical protein glysoja_041729 [Glycine soja] gi|947115103|gb|KRH63405.1| hypothetical protein GLYMA_04G174200 [Glycine max] Length = 111 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -2 Query: 139 PVKLKQKLEKLDSKMQAMVAKREEILKQLKEVETNPSEATVTT 11 P KLKQKLEKL+SKMQA+ KREEILKQL+EVE SE V + Sbjct: 68 PAKLKQKLEKLESKMQALQTKREEILKQLREVEQGASEPPVAS 110 >ref|XP_013459377.1| hypothetical protein MTR_3g437860 [Medicago truncatula] gi|657392457|gb|KEH33408.1| hypothetical protein MTR_3g437860 [Medicago truncatula] Length = 105 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -2 Query: 139 PVKLKQKLEKLDSKMQAMVAKREEILKQLKEVETNPSEATVTT 11 P LKQKLEKL++KMQA+VAK+EEILK LKE ETN +E V + Sbjct: 62 PAILKQKLEKLETKMQALVAKKEEILKLLKEAETNSTEPAVAS 104