BLASTX nr result
ID: Wisteria21_contig00031284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00031284 (433 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADW77273.1| CLE19 protein [Glycine max] gi|734319822|gb|KHN03... 67 7e-09 ref|XP_003614022.1| Clavata3/ESR (CLE) gene family member MtCLE1... 66 9e-09 gb|KRH70866.1| hypothetical protein GLYMA_02G115000 [Glycine max] 64 6e-08 gb|KHN30004.1| CLAVATA3/ESR (CLE)-related protein 9 [Glycine soja] 64 6e-08 gb|KOM53124.1| hypothetical protein LR48_Vigan09g178300 [Vigna a... 61 3e-07 ref|XP_007157583.1| hypothetical protein PHAVU_002G081400g [Phas... 61 3e-07 gb|KJB30445.1| hypothetical protein B456_005G144400 [Gossypium r... 58 2e-06 ref|XP_014492906.1| PREDICTED: CLAVATA3/ESR (CLE)-related protei... 58 3e-06 gb|KDO83096.1| hypothetical protein CISIN_1g048198mg [Citrus sin... 58 3e-06 ref|XP_010066750.1| PREDICTED: CLAVATA3/ESR (CLE)-related protei... 58 3e-06 gb|EYU28839.1| hypothetical protein MIMGU_mgv1a017967mg [Erythra... 58 3e-06 ref|XP_006483690.1| PREDICTED: CLAVATA3/ESR (CLE)-related protei... 58 3e-06 ref|XP_006438801.1| hypothetical protein CICLE_v10033671mg [Citr... 58 3e-06 ref|XP_007045924.1| Uncharacterized protein TCM_011583 [Theobrom... 57 5e-06 ref|XP_006600784.1| PREDICTED: CLAVATA3/ESR (CLE)-related protei... 57 5e-06 ref|XP_011088085.1| PREDICTED: CLAVATA3/ESR (CLE)-related protei... 57 7e-06 ref|XP_006579726.1| PREDICTED: protein FON2 SPARE1-like [Glycine... 57 7e-06 ref|XP_010096579.1| hypothetical protein L484_004255 [Morus nota... 56 9e-06 gb|KMT08978.1| hypothetical protein BVRB_6g136910 [Beta vulgaris... 56 9e-06 ref|XP_009103096.1| PREDICTED: CLAVATA3/ESR (CLE)-related protei... 56 9e-06 >gb|ADW77273.1| CLE19 protein [Glycine max] gi|734319822|gb|KHN03631.1| CLAVATA3/ESR (CLE)-related protein 9 [Glycine soja] gi|947127150|gb|KRH75004.1| hypothetical protein GLYMA_01G056400 [Glycine max] Length = 107 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -1 Query: 433 RIHHRLHKPVPPSQDYSIDPRYGVEKRLVPSGPNPLHN 320 RIH RL + VPPSQ+ IDPR+G EKRLVPSGPNPLHN Sbjct: 70 RIHQRLFEAVPPSQENGIDPRFGAEKRLVPSGPNPLHN 107 >ref|XP_003614022.1| Clavata3/ESR (CLE) gene family member MtCLE16 [Medicago truncatula] gi|355515357|gb|AES96980.1| Clavata3/ESR (CLE) gene family member MtCLE16 [Medicago truncatula] Length = 101 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = -1 Query: 433 RIHHRLHKPVPPSQDYSIDPRYGVEKRLVPSGPNPLHN 320 RIH RLH V PS DY IDPR+G EKR VP+GPNPLHN Sbjct: 64 RIHQRLHNQVSPSHDYGIDPRFGAEKRRVPTGPNPLHN 101 >gb|KRH70866.1| hypothetical protein GLYMA_02G115000 [Glycine max] Length = 101 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -1 Query: 430 IHHRLHKPVPPSQDYSIDPRYGVEKRLVPSGPNPLHN 320 IH RL + +PPSQ+ IDPR+G EKRLVPSGPNPLHN Sbjct: 65 IHQRLIEAIPPSQENGIDPRFGAEKRLVPSGPNPLHN 101 >gb|KHN30004.1| CLAVATA3/ESR (CLE)-related protein 9 [Glycine soja] Length = 113 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -1 Query: 430 IHHRLHKPVPPSQDYSIDPRYGVEKRLVPSGPNPLHN 320 IH RL + +PPSQ+ IDPR+G EKRLVPSGPNPLHN Sbjct: 77 IHQRLIEAIPPSQENGIDPRFGAEKRLVPSGPNPLHN 113 >gb|KOM53124.1| hypothetical protein LR48_Vigan09g178300 [Vigna angularis] Length = 107 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 433 RIHHRLHKPVPPSQDYSIDPRYGVEKRLVPSGPNPLHN 320 +IH RL + +PPSQD+ DPR+G EKRLVPSGPNPLHN Sbjct: 72 KIHQRLIQTIPPSQDF--DPRFGAEKRLVPSGPNPLHN 107 >ref|XP_007157583.1| hypothetical protein PHAVU_002G081400g [Phaseolus vulgaris] gi|561030998|gb|ESW29577.1| hypothetical protein PHAVU_002G081400g [Phaseolus vulgaris] Length = 106 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 433 RIHHRLHKPVPPSQDYSIDPRYGVEKRLVPSGPNPLHN 320 +IH RL + +PPSQD+ DPR+G EKRLVPSGPNPLHN Sbjct: 71 KIHQRLIETIPPSQDF--DPRFGAEKRLVPSGPNPLHN 106 >gb|KJB30445.1| hypothetical protein B456_005G144400 [Gossypium raimondii] gi|763763192|gb|KJB30446.1| hypothetical protein B456_005G144400 [Gossypium raimondii] Length = 98 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = -1 Query: 418 LHKPVPPSQDYSIDPRYGVEKRLVPSGPNPLHN 320 L P PPS+ IDPRYGVEKRLVPSGPNPLHN Sbjct: 66 LAPPPPPSEANEIDPRYGVEKRLVPSGPNPLHN 98 >ref|XP_014492906.1| PREDICTED: CLAVATA3/ESR (CLE)-related protein 10-like [Vigna radiata var. radiata] Length = 97 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -1 Query: 433 RIHHRLHKPVPPSQDYSIDPRYGVEKRLVPSGPNPLHN 320 +IH RL + +P SQD+ DPR+G EKRLVPSGPNPLHN Sbjct: 62 KIHQRLIETIPRSQDF--DPRFGAEKRLVPSGPNPLHN 97 >gb|KDO83096.1| hypothetical protein CISIN_1g048198mg [Citrus sinensis] Length = 104 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/38 (65%), Positives = 29/38 (76%), Gaps = 2/38 (5%) Frame = -1 Query: 427 HHRLHKPVPP--SQDYSIDPRYGVEKRLVPSGPNPLHN 320 HH+ + P PP D +DPRYGVEKRLVP+GPNPLHN Sbjct: 67 HHQHYSPPPPPLGHDQIVDPRYGVEKRLVPTGPNPLHN 104 >ref|XP_010066750.1| PREDICTED: CLAVATA3/ESR (CLE)-related protein 13 [Eucalyptus grandis] gi|629099017|gb|KCW64782.1| hypothetical protein EUGRSUZ_G02356 [Eucalyptus grandis] Length = 117 Score = 57.8 bits (138), Expect = 3e-06 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = -1 Query: 427 HHRLHKPVPPSQDYSIDPRYGVEKRLVPSGPNPLHN 320 H + H+P PP IDPRYG+EKRLVP+GPNPLH+ Sbjct: 82 HGKSHRPEPPDDGREIDPRYGMEKRLVPTGPNPLHH 117 >gb|EYU28839.1| hypothetical protein MIMGU_mgv1a017967mg [Erythranthe guttata] Length = 113 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -1 Query: 409 PVPPSQDYSIDPRYGVEKRLVPSGPNPLHN 320 P PP D IDPRYGVEKRLVPSGPNPLHN Sbjct: 84 PPPPPDDDEIDPRYGVEKRLVPSGPNPLHN 113 >ref|XP_006483690.1| PREDICTED: CLAVATA3/ESR (CLE)-related protein 9-like [Citrus sinensis] Length = 115 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/38 (65%), Positives = 29/38 (76%), Gaps = 2/38 (5%) Frame = -1 Query: 427 HHRLHKPVPP--SQDYSIDPRYGVEKRLVPSGPNPLHN 320 HH+ + P PP D +DPRYGVEKRLVP+GPNPLHN Sbjct: 78 HHQHYSPPPPPLGHDQIVDPRYGVEKRLVPTGPNPLHN 115 >ref|XP_006438801.1| hypothetical protein CICLE_v10033671mg [Citrus clementina] gi|557540997|gb|ESR52041.1| hypothetical protein CICLE_v10033671mg [Citrus clementina] Length = 116 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/38 (65%), Positives = 29/38 (76%), Gaps = 2/38 (5%) Frame = -1 Query: 427 HHRLHKPVPP--SQDYSIDPRYGVEKRLVPSGPNPLHN 320 HH+ + P PP D +DPRYGVEKRLVP+GPNPLHN Sbjct: 79 HHQHYSPPPPPLGHDQIVDPRYGVEKRLVPTGPNPLHN 116 >ref|XP_007045924.1| Uncharacterized protein TCM_011583 [Theobroma cacao] gi|508709859|gb|EOY01756.1| Uncharacterized protein TCM_011583 [Theobroma cacao] Length = 196 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -1 Query: 409 PVPPSQDYSIDPRYGVEKRLVPSGPNPLHN 320 P PPS+ IDPRYGVEKRLVPSGPNPLHN Sbjct: 167 PPPPSELNEIDPRYGVEKRLVPSGPNPLHN 196 >ref|XP_006600784.1| PREDICTED: CLAVATA3/ESR (CLE)-related protein 13-like [Glycine max] gi|321172980|gb|ADW77274.1| CLE20 protein [Glycine max] gi|734344336|gb|KHN10421.1| CLAVATA3/ESR (CLE)-related protein 13 [Glycine soja] gi|947054364|gb|KRH03817.1| hypothetical protein GLYMA_17G121800 [Glycine max] Length = 114 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/41 (65%), Positives = 31/41 (75%), Gaps = 3/41 (7%) Frame = -1 Query: 433 RIHHRLH---KPVPPSQDYSIDPRYGVEKRLVPSGPNPLHN 320 R HHR H VP S++ IDPRYGVEKRLVP+GPNPLH+ Sbjct: 74 RGHHRRHHHRSRVPESKETEIDPRYGVEKRLVPTGPNPLHH 114 >ref|XP_011088085.1| PREDICTED: CLAVATA3/ESR (CLE)-related protein 10-like [Sesamum indicum] Length = 116 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/44 (61%), Positives = 30/44 (68%), Gaps = 8/44 (18%) Frame = -1 Query: 427 HHRLHKPVPP--------SQDYSIDPRYGVEKRLVPSGPNPLHN 320 HH +P+PP + D IDPRYGVEKRLVPSGPNPLHN Sbjct: 73 HHPPQRPLPPPPPPPPCSNGDDDIDPRYGVEKRLVPSGPNPLHN 116 >ref|XP_006579726.1| PREDICTED: protein FON2 SPARE1-like [Glycine max] gi|321172982|gb|ADW77275.1| CLE21 protein [Glycine max] gi|734359141|gb|KHN15154.1| CLAVATA3/ESR (CLE)-related protein 13 [Glycine soja] gi|947108371|gb|KRH56697.1| hypothetical protein GLYMA_05G013600 [Glycine max] Length = 118 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -1 Query: 427 HHRLHKPVPPSQDYSIDPRYGVEKRLVPSGPNPLHN 320 HH VP S++ IDPRYGVEKRLVP+GPNPLH+ Sbjct: 83 HHHHRSGVPESKETEIDPRYGVEKRLVPTGPNPLHH 118 >ref|XP_010096579.1| hypothetical protein L484_004255 [Morus notabilis] gi|587875982|gb|EXB65079.1| hypothetical protein L484_004255 [Morus notabilis] Length = 113 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = -1 Query: 415 HKPVPPSQDYSIDPRYGVEKRLVPSGPNPLHN 320 H PPSQ IDPRYGVEKRLVPSGPNPLHN Sbjct: 82 HYLPPPSQLGEIDPRYGVEKRLVPSGPNPLHN 113 >gb|KMT08978.1| hypothetical protein BVRB_6g136910 [Beta vulgaris subsp. vulgaris] Length = 115 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -1 Query: 409 PVPPSQDYSIDPRYGVEKRLVPSGPNPLHN 320 P PPS IDPRYGVEKRLVPSGPNPLHN Sbjct: 86 PPPPSLASEIDPRYGVEKRLVPSGPNPLHN 115 >ref|XP_009103096.1| PREDICTED: CLAVATA3/ESR (CLE)-related protein 9-like [Brassica rapa] Length = 118 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/42 (66%), Positives = 32/42 (76%), Gaps = 4/42 (9%) Frame = -1 Query: 433 RIHHR--LHKPV--PPSQDYSIDPRYGVEKRLVPSGPNPLHN 320 RIHHR +P+ PP +IDPRYGV+KRLVPSGPNPLHN Sbjct: 77 RIHHRSTTKQPLVSPPPPPPAIDPRYGVDKRLVPSGPNPLHN 118