BLASTX nr result
ID: Wisteria21_contig00030948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00030948 (307 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AIG89840.1| hypothetical protein (mitochondrion) [Capsicum an... 94 4e-17 >gb|AIG89840.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 131 Score = 94.0 bits (232), Expect = 4e-17 Identities = 53/85 (62%), Positives = 55/85 (64%) Frame = -2 Query: 255 VAHAVDLSLDI*RERCESHSLSFMAAPRLTALRYYYCDVSGSNWF*FPNSPGRNLYAALI 76 VAHA D SL RERCES+SL P L LRYYYCDVSGSNW S L + Sbjct: 36 VAHAADHSLRE-RERCESNSLMLWPPPDLRPLRYYYCDVSGSNWLNLSQSSWPELVCSTC 94 Query: 75 RRCMHKGLELFSYLNLKDRTLPYSR 1 HKGLELFSYLNLKDRTLPYSR Sbjct: 95 TE--HKGLELFSYLNLKDRTLPYSR 117