BLASTX nr result
ID: Wisteria21_contig00030762
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00030762 (754 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum]... 53 2e-06 gb|AIK21304.1| ATP synthase CF0 subunit I (chloroplast) [Lathyru... 60 2e-06 >gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum] gi|224352|prf||1102209F ORF 6 Length = 79 Score = 52.8 bits (125), Expect(3) = 2e-06 Identities = 29/50 (58%), Positives = 33/50 (66%) Frame = +1 Query: 22 MKVDSLSIHFKMSMISSRTKHESFNSFGSHTQFLIGNFPIFIL**AYPLF 171 MKVD SI F+ S+I SRTKHESF+SFGSH Q L N IF P+F Sbjct: 1 MKVDYFSIPFQNSIIPSRTKHESFDSFGSHAQLLKVNSHIFFYECNEPIF 50 Score = 24.6 bits (52), Expect(3) = 2e-06 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +3 Query: 162 SSFLYF*KD*KILKMIINTRPKYLEDSSDQTNN 260 SS F KD + N PKY EDSSD+ N Sbjct: 51 SSLFIFQKD-----IETNVIPKYSEDSSDKIKN 78 Score = 21.9 bits (45), Expect(3) = 2e-06 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +2 Query: 149 CNEPILFSLFL 181 CNEPI SLF+ Sbjct: 45 CNEPIFSSLFI 55 >gb|AIK21304.1| ATP synthase CF0 subunit I (chloroplast) [Lathyrus sativus] Length = 204 Score = 59.7 bits (143), Expect = 2e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 754 IFFGKGVCASCLFQRIDWIQPTALFFVIT 668 IFFGKGVCASCLFQRIDWIQPTALF +++ Sbjct: 42 IFFGKGVCASCLFQRIDWIQPTALFLLLS 70