BLASTX nr result
ID: Wisteria21_contig00030529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00030529 (263 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012573562.1| PREDICTED: uncharacterized protein LOC101498... 103 5e-20 ref|XP_013457941.1| HNH endonuclease domain protein [Medicago tr... 102 1e-19 gb|KHN48711.1| hypothetical protein glysoja_015859 [Glycine soja... 99 2e-18 ref|NP_001235440.1| uncharacterized protein LOC100527904 [Glycin... 99 2e-18 ref|XP_006600159.1| PREDICTED: uncharacterized protein LOC100775... 98 2e-18 ref|NP_001242848.1| uncharacterized protein LOC100775923 [Glycin... 98 2e-18 ref|XP_014507015.1| PREDICTED: uncharacterized protein LOC106766... 96 1e-17 ref|XP_014507013.1| PREDICTED: formin-like protein 20 isoform X1... 96 1e-17 gb|KOM33206.1| hypothetical protein LR48_Vigan01g276200 [Vigna a... 95 2e-17 ref|XP_007155278.1| hypothetical protein PHAVU_003G187600g [Phas... 95 2e-17 ref|XP_007155277.1| hypothetical protein PHAVU_003G187600g [Phas... 95 2e-17 ref|XP_011072818.1| PREDICTED: uncharacterized protein LOC105157... 94 5e-17 ref|XP_011072817.1| PREDICTED: uncharacterized protein LOC105157... 94 5e-17 ref|XP_006844847.2| PREDICTED: uncharacterized protein LOC184347... 92 1e-16 ref|XP_010537383.1| PREDICTED: uncharacterized protein LOC104812... 92 1e-16 gb|KDO55457.1| hypothetical protein CISIN_1g029699mg [Citrus sin... 92 1e-16 ref|XP_006494992.1| PREDICTED: uncharacterized protein LOC102627... 92 1e-16 ref|XP_006440665.1| hypothetical protein CICLE_v10022490mg [Citr... 92 1e-16 gb|ERN06522.1| hypothetical protein AMTR_s00058p00091420 [Ambore... 92 1e-16 ref|XP_008239890.1| PREDICTED: uncharacterized protein LOC103338... 92 2e-16 >ref|XP_012573562.1| PREDICTED: uncharacterized protein LOC101498447 [Cicer arietinum] Length = 167 Score = 103 bits (257), Expect = 5e-20 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +1 Query: 124 FDSKTKSICWAKADTVPDRHPERWRKDAAGNIVCKRFFNCLGCLCY 261 FD+KTKSICW+KADTVP RHPERWRKDAAGNIVCKRFFNCLGCLCY Sbjct: 25 FDTKTKSICWSKADTVPGRHPERWRKDAAGNIVCKRFFNCLGCLCY 70 >ref|XP_013457941.1| HNH endonuclease domain protein [Medicago truncatula] gi|657390451|gb|KEH31972.1| HNH endonuclease domain protein [Medicago truncatula] Length = 165 Score = 102 bits (253), Expect = 1e-19 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +1 Query: 124 FDSKTKSICWAKADTVPDRHPERWRKDAAGNIVCKRFFNCLGCLCY 261 FD+KTK+ICW KADTVP RHPERWRKDAAGNIVCKRFFNCLGCLCY Sbjct: 23 FDTKTKNICWTKADTVPGRHPERWRKDAAGNIVCKRFFNCLGCLCY 68 >gb|KHN48711.1| hypothetical protein glysoja_015859 [Glycine soja] gi|947108549|gb|KRH56875.1| hypothetical protein GLYMA_05G024300 [Glycine max] Length = 162 Score = 98.6 bits (244), Expect = 2e-18 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = +1 Query: 124 FDSKTKSICWAKADTVPDRHPERWRKDAAGNIVCKRFFNCLGCLCY 261 FDS K+ICW+KADTVP RHPERWRKDAAGN+VCKRFFNC+GCLCY Sbjct: 20 FDSNAKAICWSKADTVPGRHPERWRKDAAGNVVCKRFFNCIGCLCY 65 >ref|NP_001235440.1| uncharacterized protein LOC100527904 [Glycine max] gi|255633516|gb|ACU17116.1| unknown [Glycine max] Length = 162 Score = 98.6 bits (244), Expect = 2e-18 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = +1 Query: 124 FDSKTKSICWAKADTVPDRHPERWRKDAAGNIVCKRFFNCLGCLCY 261 FDS K+ICW+KADTVP RHPERWRKDAAGN+VCKRFFNC+GCLCY Sbjct: 20 FDSNAKAICWSKADTVPGRHPERWRKDAAGNVVCKRFFNCIGCLCY 65 >ref|XP_006600159.1| PREDICTED: uncharacterized protein LOC100775923 isoform X1 [Glycine max] gi|734367930|gb|KHN18576.1| hypothetical protein glysoja_006989 [Glycine soja] gi|947054078|gb|KRH03531.1| hypothetical protein GLYMA_17G103000 [Glycine max] Length = 162 Score = 98.2 bits (243), Expect = 2e-18 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +1 Query: 124 FDSKTKSICWAKADTVPDRHPERWRKDAAGNIVCKRFFNCLGCLCY 261 FDS K+ICW KADTVP RHPERWRKDAAGN+VCKRFFNC+GCLCY Sbjct: 20 FDSNAKAICWGKADTVPGRHPERWRKDAAGNVVCKRFFNCIGCLCY 65 >ref|NP_001242848.1| uncharacterized protein LOC100775923 [Glycine max] gi|255641881|gb|ACU21209.1| unknown [Glycine max] Length = 121 Score = 98.2 bits (243), Expect = 2e-18 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +1 Query: 124 FDSKTKSICWAKADTVPDRHPERWRKDAAGNIVCKRFFNCLGCLCY 261 FDS K+ICW KADTVP RHPERWRKDAAGN+VCKRFFNC+GCLCY Sbjct: 20 FDSNAKAICWGKADTVPGRHPERWRKDAAGNVVCKRFFNCIGCLCY 65 >ref|XP_014507015.1| PREDICTED: uncharacterized protein LOC106766777 isoform X3 [Vigna radiata var. radiata] gi|951001191|ref|XP_014507016.1| PREDICTED: uncharacterized protein LOC106766777 isoform X4 [Vigna radiata var. radiata] Length = 163 Score = 95.5 bits (236), Expect = 1e-17 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = +1 Query: 124 FDSKTKSICWAKADTVPDRHPERWRKDAAGNIVCKRFFNCLGCLCY 261 FDS K+ICW+KAD VP RHPERWRKDAAGNIVCKRF+NC+GCLCY Sbjct: 19 FDSNAKAICWSKADIVPGRHPERWRKDAAGNIVCKRFYNCIGCLCY 64 >ref|XP_014507013.1| PREDICTED: formin-like protein 20 isoform X1 [Vigna radiata var. radiata] Length = 643 Score = 95.5 bits (236), Expect = 1e-17 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = +1 Query: 124 FDSKTKSICWAKADTVPDRHPERWRKDAAGNIVCKRFFNCLGCLCY 261 FDS K+ICW+KAD VP RHPERWRKDAAGNIVCKRF+NC+GCLCY Sbjct: 19 FDSNAKAICWSKADIVPGRHPERWRKDAAGNIVCKRFYNCIGCLCY 64 >gb|KOM33206.1| hypothetical protein LR48_Vigan01g276200 [Vigna angularis] Length = 163 Score = 94.7 bits (234), Expect = 2e-17 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = +1 Query: 124 FDSKTKSICWAKADTVPDRHPERWRKDAAGNIVCKRFFNCLGCLCY 261 FDS K++CW+KAD VP RHPERWRKDAAGNIVCKRF+NC+GCLCY Sbjct: 19 FDSNAKTLCWSKADIVPGRHPERWRKDAAGNIVCKRFYNCIGCLCY 64 >ref|XP_007155278.1| hypothetical protein PHAVU_003G187600g [Phaseolus vulgaris] gi|561028632|gb|ESW27272.1| hypothetical protein PHAVU_003G187600g [Phaseolus vulgaris] Length = 118 Score = 94.7 bits (234), Expect = 2e-17 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +1 Query: 124 FDSKTKSICWAKADTVPDRHPERWRKDAAGNIVCKRFFNCLGCLCY 261 FDS K+ICW+KADTV RHPERWRKDAAGNIVCKRF+NCLGCLCY Sbjct: 19 FDSNAKAICWSKADTVLGRHPERWRKDAAGNIVCKRFYNCLGCLCY 64 >ref|XP_007155277.1| hypothetical protein PHAVU_003G187600g [Phaseolus vulgaris] gi|561028631|gb|ESW27271.1| hypothetical protein PHAVU_003G187600g [Phaseolus vulgaris] Length = 163 Score = 94.7 bits (234), Expect = 2e-17 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +1 Query: 124 FDSKTKSICWAKADTVPDRHPERWRKDAAGNIVCKRFFNCLGCLCY 261 FDS K+ICW+KADTV RHPERWRKDAAGNIVCKRF+NCLGCLCY Sbjct: 19 FDSNAKAICWSKADTVLGRHPERWRKDAAGNIVCKRFYNCLGCLCY 64 >ref|XP_011072818.1| PREDICTED: uncharacterized protein LOC105157958 isoform X2 [Sesamum indicum] Length = 126 Score = 93.6 bits (231), Expect = 5e-17 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = +1 Query: 124 FDSKTKSICWAKADTVPDRHPERWRKDAAGNIVCKRFFNCLGCLCY 261 FDSK KSICWA A+TVP RHPERWRKDAAGNIVCKRF NC GCLC+ Sbjct: 25 FDSKAKSICWANAETVPGRHPERWRKDAAGNIVCKRFCNCQGCLCF 70 >ref|XP_011072817.1| PREDICTED: uncharacterized protein LOC105157958 isoform X1 [Sesamum indicum] Length = 175 Score = 93.6 bits (231), Expect = 5e-17 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = +1 Query: 124 FDSKTKSICWAKADTVPDRHPERWRKDAAGNIVCKRFFNCLGCLCY 261 FDSK KSICWA A+TVP RHPERWRKDAAGNIVCKRF NC GCLC+ Sbjct: 25 FDSKAKSICWANAETVPGRHPERWRKDAAGNIVCKRFCNCQGCLCF 70 >ref|XP_006844847.2| PREDICTED: uncharacterized protein LOC18434721 [Amborella trichopoda] Length = 200 Score = 92.4 bits (228), Expect = 1e-16 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = +1 Query: 121 SFDSKTKSICWAKADTVPDRHPERWRKDAAGNIVCKRFFNCLGCLCY 261 +FD+KT+++CW KAD VP RHPERWRKDAAGN++CKRF+NC GCLCY Sbjct: 52 TFDAKTRTMCWEKADVVPGRHPERWRKDAAGNVLCKRFWNCTGCLCY 98 >ref|XP_010537383.1| PREDICTED: uncharacterized protein LOC104812097 [Tarenaya hassleriana] Length = 193 Score = 92.4 bits (228), Expect = 1e-16 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = +1 Query: 124 FDSKTKSICWAKADTVPDRHPERWRKDAAGNIVCKRFFNCLGCLCY 261 FD+KTKS+CWA AD +P RHPERWRKDAAGNIVCKRF NC GCLC+ Sbjct: 49 FDAKTKSLCWANADIIPGRHPERWRKDAAGNIVCKRFCNCSGCLCF 94 >gb|KDO55457.1| hypothetical protein CISIN_1g029699mg [Citrus sinensis] Length = 189 Score = 92.4 bits (228), Expect = 1e-16 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = +1 Query: 124 FDSKTKSICWAKADTVPDRHPERWRKDAAGNIVCKRFFNCLGCLCY 261 FD K KS+CWAKA+TVP RHPERWRKDAAGNIVCKRF NC GCLC+ Sbjct: 29 FDGKAKSMCWAKAETVPGRHPERWRKDAAGNIVCKRFCNCHGCLCF 74 >ref|XP_006494992.1| PREDICTED: uncharacterized protein LOC102627352 [Citrus sinensis] Length = 177 Score = 92.4 bits (228), Expect = 1e-16 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = +1 Query: 124 FDSKTKSICWAKADTVPDRHPERWRKDAAGNIVCKRFFNCLGCLCY 261 FD K KS+CWAKA+TVP RHPERWRKDAAGNIVCKRF NC GCLC+ Sbjct: 29 FDGKAKSMCWAKAETVPGRHPERWRKDAAGNIVCKRFCNCHGCLCF 74 >ref|XP_006440665.1| hypothetical protein CICLE_v10022490mg [Citrus clementina] gi|557542927|gb|ESR53905.1| hypothetical protein CICLE_v10022490mg [Citrus clementina] Length = 181 Score = 92.4 bits (228), Expect = 1e-16 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = +1 Query: 124 FDSKTKSICWAKADTVPDRHPERWRKDAAGNIVCKRFFNCLGCLCY 261 FD K KS+CWAKA+TVP RHPERWRKDAAGNIVCKRF NC GCLC+ Sbjct: 33 FDGKAKSMCWAKAETVPGRHPERWRKDAAGNIVCKRFCNCHGCLCF 78 >gb|ERN06522.1| hypothetical protein AMTR_s00058p00091420 [Amborella trichopoda] Length = 170 Score = 92.4 bits (228), Expect = 1e-16 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = +1 Query: 121 SFDSKTKSICWAKADTVPDRHPERWRKDAAGNIVCKRFFNCLGCLCY 261 +FD+KT+++CW KAD VP RHPERWRKDAAGN++CKRF+NC GCLCY Sbjct: 22 TFDAKTRTMCWEKADVVPGRHPERWRKDAAGNVLCKRFWNCTGCLCY 68 >ref|XP_008239890.1| PREDICTED: uncharacterized protein LOC103338463 [Prunus mume] Length = 177 Score = 92.0 bits (227), Expect = 2e-16 Identities = 38/46 (82%), Positives = 40/46 (86%) Frame = +1 Query: 124 FDSKTKSICWAKADTVPDRHPERWRKDAAGNIVCKRFFNCLGCLCY 261 FDSK KS CWAKAD VP RHPERWRKDAAGN+VCKRF NC GCLC+ Sbjct: 35 FDSKAKSNCWAKADVVPGRHPERWRKDAAGNVVCKRFCNCQGCLCF 80