BLASTX nr result
ID: Wisteria21_contig00030496
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00030496 (444 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003598009.2| hypothetical protein MTR_3g005230 [Medicago ... 59 1e-06 >ref|XP_003598009.2| hypothetical protein MTR_3g005230 [Medicago truncatula] gi|657391573|gb|AES68260.2| hypothetical protein MTR_3g005230 [Medicago truncatula] Length = 259 Score = 59.3 bits (142), Expect = 1e-06 Identities = 37/75 (49%), Positives = 41/75 (54%), Gaps = 11/75 (14%) Frame = +3 Query: 225 MESSNGLSNSQHTGTPFPLPPKSTSQAECFE-------GFSEGLRRHQRTYSDSMLSE-- 377 ME SN L N Q P + S C + G G+RRHQRTYSDSMLSE Sbjct: 1 MEISNSLPNFQDHQLPPKISNSSRYDEICLKERLMSELGNEGGIRRHQRTYSDSMLSEQQ 60 Query: 378 --EVPSWLKELLDDE 416 EVP WLK+LLDDE Sbjct: 61 QQEVPCWLKDLLDDE 75