BLASTX nr result
ID: Wisteria21_contig00030465
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00030465 (323 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN33900.1| Putative ribonuclease H protein, partial [Glycine... 40 9e-08 >gb|KHN33900.1| Putative ribonuclease H protein, partial [Glycine soja] Length = 385 Score = 40.0 bits (92), Expect(3) = 9e-08 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = -2 Query: 316 SCERCGVVQKSILHTLRDCYRLKRIWE-LQFAQNQDFFDQT*KD*IIQNL 170 SC RC Q+ ILH LRDC+ +++W+ LQ + +F+ D I+ N+ Sbjct: 237 SCNRCMHGQEIILHLLRDCHYSRQVWQFLQLDHDSNFYVANYMDWIVNNI 286 Score = 37.0 bits (84), Expect(3) = 9e-08 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = -3 Query: 129 IWKSRNSEVFNDIRWKEWYTMNHIHTLLDSIL 34 IWKSRNS +F + RW W +N ++ L + ++ Sbjct: 301 IWKSRNSLIFPNKRWTTWQIVNQVNILFNDVI 332 Score = 25.0 bits (53), Expect(3) = 9e-08 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 167 STNGSLFAMTCWT 129 S G LFA+TCWT Sbjct: 288 SVRGILFAVTCWT 300