BLASTX nr result
ID: Wisteria21_contig00030220
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00030220 (295 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH03401.1| hypothetical protein GLYMA_17G095600 [Glycine max] 65 2e-08 >gb|KRH03401.1| hypothetical protein GLYMA_17G095600 [Glycine max] Length = 94 Score = 65.1 bits (157), Expect = 2e-08 Identities = 38/77 (49%), Positives = 42/77 (54%), Gaps = 1/77 (1%) Frame = -3 Query: 290 ESMVCSFLSGMPVCMIIQL*IXXXXXXXXXXXXXXL-WHNLSSPWCRIYHQKQHDTELCR 114 ES CSFLSG P+ M I WHNLSSPWC I +QKQ DT+LCR Sbjct: 3 ESRDCSFLSGKPMGMYDNRTINFVISPQRKLRSGLFLWHNLSSPWCMICNQKQRDTQLCR 62 Query: 113 LVSHFFLEFLHSRGPPK 63 L SHFF F +G PK Sbjct: 63 LGSHFFSIFTF-KGSPK 78