BLASTX nr result
ID: Wisteria21_contig00030106
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00030106 (242 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003603541.1| type 2 (PTH2)-like peptidyl-tRNA hydrolase [... 75 1e-11 ref|XP_007137125.1| hypothetical protein PHAVU_009G101700g [Phas... 69 2e-09 ref|XP_004501239.1| PREDICTED: putative peptidyl-tRNA hydrolase ... 66 1e-08 ref|XP_014499313.1| PREDICTED: putative peptidyl-tRNA hydrolase ... 57 5e-06 >ref|XP_003603541.1| type 2 (PTH2)-like peptidyl-tRNA hydrolase [Medicago truncatula] gi|355492589|gb|AES73792.1| type 2 (PTH2)-like peptidyl-tRNA hydrolase [Medicago truncatula] Length = 206 Score = 75.5 bits (184), Expect = 1e-11 Identities = 43/67 (64%), Positives = 48/67 (71%) Frame = +1 Query: 31 SLSMACTIPSLRLFGPSGSCLALSSTNISVTHLHAASSWNRASGLSSNSMSQPSAADPNT 210 SLSMA TIP+LRLF PSGS LA S T SVT LHAAS N+ S L+ NSMSQP+A D Sbjct: 20 SLSMAYTIPTLRLFNPSGSYLAFSRTKFSVT-LHAASFSNKTSQLNRNSMSQPAATDSTN 78 Query: 211 LSTSNDA 231 LST D+ Sbjct: 79 LSTPTDS 85 >ref|XP_007137125.1| hypothetical protein PHAVU_009G101700g [Phaseolus vulgaris] gi|561010212|gb|ESW09119.1| hypothetical protein PHAVU_009G101700g [Phaseolus vulgaris] Length = 189 Score = 68.6 bits (166), Expect = 2e-09 Identities = 41/66 (62%), Positives = 46/66 (69%), Gaps = 2/66 (3%) Frame = +1 Query: 40 MACTIPSLRLFGPSGSCLALSSTNISVT--HLHAASSWNRASGLSSNSMSQPSAADPNTL 213 MACTIP LRLF PS S LA S+T++ VT H A S RAS LSSNSMSQP+A D N Sbjct: 1 MACTIP-LRLFTPSASNLAFSTTSVRVTLTHFRAPSILTRASPLSSNSMSQPAATDLNAA 59 Query: 214 STSNDA 231 T+NDA Sbjct: 60 VTANDA 65 >ref|XP_004501239.1| PREDICTED: putative peptidyl-tRNA hydrolase PTRHD1 [Cicer arietinum] Length = 192 Score = 65.9 bits (159), Expect = 1e-08 Identities = 41/68 (60%), Positives = 50/68 (73%), Gaps = 4/68 (5%) Frame = +1 Query: 40 MACTIPSLRLFGPSGSCLALSST--NISVTHLHAASSW-NRASGLSSNSMSQPSA-ADPN 207 MACT S+RLF PSGS LA S+T +++V HL A+S+ NRAS L+S SMSQP A D + Sbjct: 1 MACTFSSIRLFNPSGSHLAYSTTKSSVAVPHLFQATSFSNRASRLTSYSMSQPVAETDSS 60 Query: 208 TLSTSNDA 231 TLST NDA Sbjct: 61 TLSTPNDA 68 >ref|XP_014499313.1| PREDICTED: putative peptidyl-tRNA hydrolase PTRHD1 [Vigna radiata var. radiata] Length = 186 Score = 57.0 bits (136), Expect = 5e-06 Identities = 37/62 (59%), Positives = 42/62 (67%) Frame = +1 Query: 43 ACTIPSLRLFGPSGSCLALSSTNISVTHLHAASSWNRASGLSSNSMSQPSAADPNTLSTS 222 ACT+P LRLF PSGS LA S+T+ VTH S R S L SNSMSQP AAD N L+T+ Sbjct: 6 ACTVP-LRLFTPSGSNLAFSNTSFRVTH----SILTRPSQLISNSMSQP-AADLNVLATT 59 Query: 223 ND 228 D Sbjct: 60 KD 61