BLASTX nr result
ID: Wisteria21_contig00030097
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00030097 (244 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003596836.1| germin-like protein 9-2 [Medicago truncatula... 89 1e-15 ref|XP_003596835.1| germin-like protein 9-2 [Medicago truncatula... 89 1e-15 ref|XP_004487727.1| PREDICTED: germin-like protein 9-3 [Cicer ar... 88 3e-15 ref|XP_003596837.1| germin-like protein 9-2 [Medicago truncatula... 87 5e-15 gb|AKA42974.1| germin-like protein 9 [Arachis hypogaea] 76 9e-12 ref|XP_014522670.1| PREDICTED: germin-like protein 9-3 [Vigna ra... 75 1e-11 ref|XP_007150060.1| hypothetical protein PHAVU_005G122900g [Phas... 75 2e-11 ref|XP_012458505.1| PREDICTED: germin-like protein 9-3 [Gossypiu... 74 3e-11 ref|XP_007206494.1| hypothetical protein PRUPE_ppa019114mg [Prun... 73 1e-10 ref|XP_003539472.1| PREDICTED: germin-like protein 9-3-like [Gly... 73 1e-10 gb|KHN29804.1| Putative germin-like protein 9-2 [Glycine soja] 72 1e-10 ref|XP_006605930.1| PREDICTED: putative germin-like protein 9-2-... 72 1e-10 ref|XP_013455808.1| germin-like protein 9-2 [Medicago truncatula... 72 2e-10 gb|AAO32795.1| germin-like protein 1 [Medicago truncatula] 72 2e-10 ref|XP_013455809.1| germin-like protein 9-2 [Medicago truncatula... 71 3e-10 ref|XP_004506196.1| PREDICTED: germin-like protein 9-3 [Cicer ar... 71 3e-10 ref|XP_003540804.1| PREDICTED: germin-like protein 9-3-like [Gly... 70 6e-10 ref|XP_008391137.1| PREDICTED: germin-like protein 9-3 [Malus do... 69 1e-09 ref|XP_008355235.1| PREDICTED: putative germin-like protein 9-2 ... 69 1e-09 ref|XP_008351299.1| PREDICTED: putative germin-like protein 9-2 ... 69 1e-09 >ref|XP_003596836.1| germin-like protein 9-2 [Medicago truncatula] gi|355485884|gb|AES67087.1| germin-like protein 9-2 [Medicago truncatula] Length = 206 Score = 89.0 bits (219), Expect = 1e-15 Identities = 42/48 (87%), Positives = 47/48 (97%) Frame = -3 Query: 164 KVLTLIISTFAIVQITMAGDPDILTDFIAPNGSQVDGSFFTFTGFRAL 21 K+LTLIIS FAIVQIT+AGDPDILTDFIAPNG+QVDG+FFT+TGFRAL Sbjct: 8 KLLTLIISAFAIVQITLAGDPDILTDFIAPNGTQVDGNFFTYTGFRAL 55 >ref|XP_003596835.1| germin-like protein 9-2 [Medicago truncatula] gi|355485883|gb|AES67086.1| germin-like protein 9-2 [Medicago truncatula] Length = 206 Score = 89.0 bits (219), Expect = 1e-15 Identities = 42/48 (87%), Positives = 47/48 (97%) Frame = -3 Query: 164 KVLTLIISTFAIVQITMAGDPDILTDFIAPNGSQVDGSFFTFTGFRAL 21 K+LTLIIS FAIVQIT+AGDPDILTDFIAPNG+QVDG+FFT+TGFRAL Sbjct: 8 KMLTLIISAFAIVQITLAGDPDILTDFIAPNGTQVDGNFFTYTGFRAL 55 >ref|XP_004487727.1| PREDICTED: germin-like protein 9-3 [Cicer arietinum] Length = 205 Score = 87.8 bits (216), Expect = 3e-15 Identities = 42/53 (79%), Positives = 49/53 (92%) Frame = -3 Query: 164 KVLTLIISTFAIVQITMAGDPDILTDFIAPNGSQVDGSFFTFTGFRALLQDTT 6 KVLTLIIS+ A++QIT+AGDPDILTDFIAP GSQ+DG+FFTFTGFRALL + T Sbjct: 7 KVLTLIISSLALMQITVAGDPDILTDFIAPFGSQIDGNFFTFTGFRALLPNNT 59 >ref|XP_003596837.1| germin-like protein 9-2 [Medicago truncatula] gi|355485885|gb|AES67088.1| germin-like protein 9-2 [Medicago truncatula] Length = 205 Score = 87.0 bits (214), Expect = 5e-15 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = -3 Query: 164 KVLTLIISTFAIVQITMAGDPDILTDFIAPNGSQVDGSFFTFTGFRALL 18 K+LTLIIS FAIVQIT+A DPDILTDFIAP G+QVDG+FFTFTGFRALL Sbjct: 7 KMLTLIISAFAIVQITLASDPDILTDFIAPTGTQVDGNFFTFTGFRALL 55 >gb|AKA42974.1| germin-like protein 9 [Arachis hypogaea] Length = 206 Score = 76.3 bits (186), Expect = 9e-12 Identities = 35/54 (64%), Positives = 41/54 (75%) Frame = -3 Query: 164 KVLTLIISTFAIVQITMAGDPDILTDFIAPNGSQVDGSFFTFTGFRALLQDTTP 3 K+L L+I F I+Q TM GDPDILTDFIAP G+ ++GSFFTFTG R LL TP Sbjct: 8 KILLLMIHAFIIMQTTMGGDPDILTDFIAPEGTNINGSFFTFTGMRVLLTQETP 61 >ref|XP_014522670.1| PREDICTED: germin-like protein 9-3 [Vigna radiata var. radiata] Length = 204 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/53 (67%), Positives = 43/53 (81%) Frame = -3 Query: 164 KVLTLIISTFAIVQITMAGDPDILTDFIAPNGSQVDGSFFTFTGFRALLQDTT 6 KVLTLIIS F+I+QI+ AGDPDILTDFI P + +DG+FFTFTGFR+L T Sbjct: 7 KVLTLIISVFSIMQISSAGDPDILTDFIVPPNTTLDGNFFTFTGFRSLFLPNT 59 >ref|XP_007150060.1| hypothetical protein PHAVU_005G122900g [Phaseolus vulgaris] gi|561023324|gb|ESW22054.1| hypothetical protein PHAVU_005G122900g [Phaseolus vulgaris] Length = 204 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/53 (66%), Positives = 42/53 (79%) Frame = -3 Query: 164 KVLTLIISTFAIVQITMAGDPDILTDFIAPNGSQVDGSFFTFTGFRALLQDTT 6 KVLTLIIS F I+QI+ AGDPDILTDFI P + +DG+FFTFTGFR++ T Sbjct: 7 KVLTLIISVFTIMQISSAGDPDILTDFIVPPNTTLDGNFFTFTGFRSIFSPNT 59 >ref|XP_012458505.1| PREDICTED: germin-like protein 9-3 [Gossypium raimondii] gi|763810433|gb|KJB77335.1| hypothetical protein B456_012G132000 [Gossypium raimondii] Length = 206 Score = 74.3 bits (181), Expect = 3e-11 Identities = 32/53 (60%), Positives = 44/53 (83%) Frame = -3 Query: 164 KVLTLIISTFAIVQITMAGDPDILTDFIAPNGSQVDGSFFTFTGFRALLQDTT 6 K+L+L++S+F IVQI +AGDPDIL+DF+ PN + VDGSFFT+TG R L+ +T Sbjct: 9 KLLSLVLSSFVIVQIALAGDPDILSDFLVPNQNNVDGSFFTYTGMRVLVNQST 61 >ref|XP_007206494.1| hypothetical protein PRUPE_ppa019114mg [Prunus persica] gi|462402136|gb|EMJ07693.1| hypothetical protein PRUPE_ppa019114mg [Prunus persica] Length = 208 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/54 (61%), Positives = 41/54 (75%) Frame = -3 Query: 164 KVLTLIISTFAIVQITMAGDPDILTDFIAPNGSQVDGSFFTFTGFRALLQDTTP 3 K +L+IS+FAIVQ+ MAGDPDILTDF+ P VDG+FFT+TGFR L+ P Sbjct: 9 KFFSLLISSFAIVQMAMAGDPDILTDFVVPPNGTVDGNFFTYTGFRVLVGGAPP 62 >ref|XP_003539472.1| PREDICTED: germin-like protein 9-3-like [Glycine max] gi|947077813|gb|KRH26653.1| hypothetical protein GLYMA_12G185800 [Glycine max] Length = 207 Score = 72.8 bits (177), Expect = 1e-10 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = -3 Query: 164 KVLTLIISTFAIVQITMAGDPDILTDFIAPNGSQVDGSFFTFTGFRAL 21 KVLTLIIS FAI+QI+ AGDPDILTDFI P + DG+FFTFTGFR + Sbjct: 7 KVLTLIISVFAIMQISTAGDPDILTDFIVPPNTIPDGNFFTFTGFRVI 54 >gb|KHN29804.1| Putative germin-like protein 9-2 [Glycine soja] Length = 83 Score = 72.4 bits (176), Expect = 1e-10 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -3 Query: 164 KVLTLIISTFAIVQITMAGDPDILTDFIAPNGSQVDGSFFTFTGFRAL 21 KVLTLIIS FAI+QI+ AGDPDILTDFI P + +G+FFTFTGFRA+ Sbjct: 7 KVLTLIISVFAILQISTAGDPDILTDFIVPPNTIPNGNFFTFTGFRAI 54 >ref|XP_006605930.1| PREDICTED: putative germin-like protein 9-2-like [Glycine max] gi|947041160|gb|KRG90884.1| hypothetical protein GLYMA_20G119800 [Glycine max] Length = 207 Score = 72.4 bits (176), Expect = 1e-10 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -3 Query: 164 KVLTLIISTFAIVQITMAGDPDILTDFIAPNGSQVDGSFFTFTGFRAL 21 KVLTLIIS FAI+QI+ AGDPDILTDFI P + +G+FFTFTGFRA+ Sbjct: 7 KVLTLIISVFAILQISTAGDPDILTDFIVPPNTIPNGNFFTFTGFRAI 54 >ref|XP_013455808.1| germin-like protein 9-2 [Medicago truncatula] gi|657387764|gb|KEH29839.1| germin-like protein 9-2 [Medicago truncatula] Length = 207 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/53 (64%), Positives = 42/53 (79%) Frame = -3 Query: 161 VLTLIISTFAIVQITMAGDPDILTDFIAPNGSQVDGSFFTFTGFRALLQDTTP 3 VL+LIISTF +V IT AGDPDILTDFI+P VD ++FTF+GFR L+Q +P Sbjct: 9 VLSLIISTFTLVTITRAGDPDILTDFISPITGPVDANYFTFSGFRVLVQPPSP 61 >gb|AAO32795.1| germin-like protein 1 [Medicago truncatula] Length = 207 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/53 (64%), Positives = 42/53 (79%) Frame = -3 Query: 161 VLTLIISTFAIVQITMAGDPDILTDFIAPNGSQVDGSFFTFTGFRALLQDTTP 3 VL+LIISTF +V IT AGDPDILTDFI+P VD ++FTF+GFR L+Q +P Sbjct: 9 VLSLIISTFTLVAITRAGDPDILTDFISPITGPVDANYFTFSGFRVLVQPPSP 61 >ref|XP_013455809.1| germin-like protein 9-2 [Medicago truncatula] gi|657387765|gb|KEH29840.1| germin-like protein 9-2 [Medicago truncatula] Length = 207 Score = 71.2 bits (173), Expect = 3e-10 Identities = 33/53 (62%), Positives = 42/53 (79%) Frame = -3 Query: 161 VLTLIISTFAIVQITMAGDPDILTDFIAPNGSQVDGSFFTFTGFRALLQDTTP 3 VL+LIISTF +V +T AGDPDILTDFI+P VD ++FTF+GFR L+Q +P Sbjct: 9 VLSLIISTFTLVTVTRAGDPDILTDFISPITGPVDANYFTFSGFRVLVQPPSP 61 >ref|XP_004506196.1| PREDICTED: germin-like protein 9-3 [Cicer arietinum] Length = 206 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/55 (61%), Positives = 46/55 (83%), Gaps = 2/55 (3%) Frame = -3 Query: 161 VLTLIISTFAIVQITMAGDPDILTDFIAPNGSQVDGSFFTFTGFRALL--QDTTP 3 VL+LIISTF ++++T AGDPDILTDFI+P +D +FFT+TGFRAL+ Q+T+P Sbjct: 9 VLSLIISTFTLMKLTRAGDPDILTDFISPLTGPIDANFFTYTGFRALVGPQNTSP 63 >ref|XP_003540804.1| PREDICTED: germin-like protein 9-3-like [Glycine max] gi|356544750|ref|XP_003540810.1| PREDICTED: germin-like protein 9-3-like [Glycine max] gi|734375922|gb|KHN21160.1| Germin-like protein 9-3 [Glycine soja] gi|947076420|gb|KRH25260.1| hypothetical protein GLYMA_12G090800 [Glycine max] gi|947076447|gb|KRH25287.1| hypothetical protein GLYMA_12G092400 [Glycine max] Length = 207 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/55 (60%), Positives = 44/55 (80%), Gaps = 1/55 (1%) Frame = -3 Query: 164 KVLTLIISTFAIVQITMAGDPDILTDFIAP-NGSQVDGSFFTFTGFRALLQDTTP 3 KV++++IS FAIVQ+ +AGDPDIL+DFI P NG DG+FFT+TGFR L+ +P Sbjct: 8 KVVSVVISAFAIVQMALAGDPDILSDFIGPINGMIPDGNFFTYTGFRVLVGQNSP 62 >ref|XP_008391137.1| PREDICTED: germin-like protein 9-3 [Malus domestica] Length = 210 Score = 69.3 bits (168), Expect = 1e-09 Identities = 37/57 (64%), Positives = 45/57 (78%), Gaps = 3/57 (5%) Frame = -3 Query: 164 KVLTLIISTFAIVQITMAGDPDILTDFIAP---NGSQVDGSFFTFTGFRALLQDTTP 3 K +LII +FAIVQI +AGDPDILTDFI P NG+ VDG+FFT+TGFRAL++ P Sbjct: 9 KFSSLIIFSFAIVQIAIAGDPDILTDFIVPPNANGT-VDGNFFTYTGFRALVEGDPP 64 >ref|XP_008355235.1| PREDICTED: putative germin-like protein 9-2 [Malus domestica] Length = 207 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/48 (64%), Positives = 40/48 (83%) Frame = -3 Query: 164 KVLTLIISTFAIVQITMAGDPDILTDFIAPNGSQVDGSFFTFTGFRAL 21 K L+L+I +FAIVQ+ MAGDPDI++DFIAP VDG+FFT+TGFR + Sbjct: 9 KFLSLLIFSFAIVQMAMAGDPDIISDFIAPPNGTVDGNFFTYTGFRVV 56 >ref|XP_008351299.1| PREDICTED: putative germin-like protein 9-2 [Malus domestica] Length = 204 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/54 (59%), Positives = 40/54 (74%) Frame = -3 Query: 164 KVLTLIISTFAIVQITMAGDPDILTDFIAPNGSQVDGSFFTFTGFRALLQDTTP 3 K +L+IS+ A VQ+ MAGDPDI+TDFIAP VDG+FFT+T FRAL+ P Sbjct: 5 KFFSLVISSIAFVQMAMAGDPDIITDFIAPPNGTVDGNFFTYTAFRALVGGGPP 58