BLASTX nr result
ID: Wisteria21_contig00029973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00029973 (477 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002536345.1| conserved hypothetical protein [Ricinus comm... 68 2e-09 ref|XP_002535070.1| conserved hypothetical protein [Ricinus comm... 65 3e-08 emb|CDY17591.1| BnaC01g27150D [Brassica napus] 61 3e-07 ref|XP_002489092.1| hypothetical protein SORBIDRAFT_0088s002240,... 60 4e-07 ref|XP_007138381.1| hypothetical protein PHAVU_009G203800g [Phas... 56 9e-06 >ref|XP_002536345.1| conserved hypothetical protein [Ricinus communis] gi|223520024|gb|EEF26037.1| conserved hypothetical protein, partial [Ricinus communis] Length = 99 Score = 68.2 bits (165), Expect = 2e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 384 EANCLPAGSCMSGNVHVRLREKGGGQKWPCC 476 +ANCL AGSCMSGNVHVR REKGGGQKWPCC Sbjct: 2 KANCLLAGSCMSGNVHVRFREKGGGQKWPCC 32 >ref|XP_002535070.1| conserved hypothetical protein [Ricinus communis] gi|223524097|gb|EEF27311.1| conserved hypothetical protein, partial [Ricinus communis] Length = 93 Score = 64.7 bits (156), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 384 EANCLPAGSCMSGNVHVRLREKGGGQKWPC 473 +ANCL AGSCMSGNVHVR REKGGGQKWPC Sbjct: 64 KANCLLAGSCMSGNVHVRFREKGGGQKWPC 93 >emb|CDY17591.1| BnaC01g27150D [Brassica napus] Length = 450 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 384 EANCLPAGSCMSGNVHVRLREKGGGQKWP 470 +ANCL AGSCMSGNVHVR REKGGGQKWP Sbjct: 352 KANCLLAGSCMSGNVHVRFREKGGGQKWP 380 >ref|XP_002489092.1| hypothetical protein SORBIDRAFT_0088s002240, partial [Sorghum bicolor] gi|241947412|gb|EES20557.1| hypothetical protein SORBIDRAFT_0088s002240, partial [Sorghum bicolor] Length = 58 Score = 60.1 bits (144), Expect(2) = 4e-07 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -2 Query: 461 LSTALLTEPYVDVTAHTATSRQAVSLPPLKRMEVWMNRHQ 342 +S LLTEPYVDVTAHTA S+QAVS PL+ MEVW+NRHQ Sbjct: 6 ISVHLLTEPYVDVTAHTAPSQQAVSF-PLEVMEVWINRHQ 44 Score = 20.8 bits (42), Expect(2) = 4e-07 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -1 Query: 477 YNKAISVH 454 YNKAISVH Sbjct: 2 YNKAISVH 9 >ref|XP_007138381.1| hypothetical protein PHAVU_009G203800g [Phaseolus vulgaris] gi|561011468|gb|ESW10375.1| hypothetical protein PHAVU_009G203800g [Phaseolus vulgaris] Length = 140 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -2 Query: 467 PFLSTALLTEPYVDVTAHTATSRQAVSLP 381 PFLSTALLTEPYVDVT HTA SRQAVSLP Sbjct: 15 PFLSTALLTEPYVDVTVHTAPSRQAVSLP 43