BLASTX nr result
ID: Wisteria21_contig00029855
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00029855 (258 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN08963.1| hypothetical protein glysoja_021785 [Glycine soja] 57 5e-06 ref|NP_001241032.1| uncharacterized protein LOC100789907 [Glycin... 57 5e-06 >gb|KHN08963.1| hypothetical protein glysoja_021785 [Glycine soja] Length = 237 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -2 Query: 257 PKTSSPMPRMIDFDDTDTDTARQPLSPLRINSPDCHIYKK 138 P+TSSPM R IDFDD + AR+PLSPLR NSPDC ++KK Sbjct: 200 PRTSSPMQRKIDFDDQEV--ARRPLSPLRHNSPDCRMHKK 237 >ref|NP_001241032.1| uncharacterized protein LOC100789907 [Glycine max] gi|255642265|gb|ACU21397.1| unknown [Glycine max] gi|947104618|gb|KRH53001.1| hypothetical protein GLYMA_06G100100 [Glycine max] Length = 327 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -2 Query: 257 PKTSSPMPRMIDFDDTDTDTARQPLSPLRINSPDCHIYKK 138 P+TSSPM R IDFDD + AR+PLSPLR NSPDC ++KK Sbjct: 290 PRTSSPMQRKIDFDDQEV--ARRPLSPLRHNSPDCRMHKK 327