BLASTX nr result
ID: Wisteria21_contig00029818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00029818 (315 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006604484.1| PREDICTED: magnesium transporter MRS2-I-like... 56 9e-06 ref|XP_006604483.1| PREDICTED: magnesium transporter MRS2-I-like... 56 9e-06 ref|XP_003554279.1| PREDICTED: magnesium transporter MRS2-I-like... 56 9e-06 >ref|XP_006604484.1| PREDICTED: magnesium transporter MRS2-I-like isoform X3 [Glycine max] Length = 317 Score = 56.2 bits (134), Expect = 9e-06 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -1 Query: 123 MTLAGSAAVELQGGSIKKKSAASRSWILLDRDGRGTVLDVD 1 M LAGS VELQ S+KKK+A SRSWILLD G+GTVLD D Sbjct: 1 MALAGSV-VELQASSVKKKTAVSRSWILLDHYGKGTVLDAD 40 >ref|XP_006604483.1| PREDICTED: magnesium transporter MRS2-I-like isoform X2 [Glycine max] gi|947045998|gb|KRG95627.1| hypothetical protein GLYMA_19G161600 [Glycine max] gi|947045999|gb|KRG95628.1| hypothetical protein GLYMA_19G161600 [Glycine max] Length = 320 Score = 56.2 bits (134), Expect = 9e-06 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -1 Query: 123 MTLAGSAAVELQGGSIKKKSAASRSWILLDRDGRGTVLDVD 1 M LAGS VELQ S+KKK+A SRSWILLD G+GTVLD D Sbjct: 1 MALAGSV-VELQASSVKKKTAVSRSWILLDHYGKGTVLDAD 40 >ref|XP_003554279.1| PREDICTED: magnesium transporter MRS2-I-like isoform X1 [Glycine max] gi|734317051|gb|KHN02533.1| Magnesium transporter MRS2-I [Glycine soja] gi|947045997|gb|KRG95626.1| hypothetical protein GLYMA_19G161600 [Glycine max] Length = 388 Score = 56.2 bits (134), Expect = 9e-06 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -1 Query: 123 MTLAGSAAVELQGGSIKKKSAASRSWILLDRDGRGTVLDVD 1 M LAGS VELQ S+KKK+A SRSWILLD G+GTVLD D Sbjct: 1 MALAGSV-VELQASSVKKKTAVSRSWILLDHYGKGTVLDAD 40