BLASTX nr result
ID: Wisteria21_contig00029417
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00029417 (630 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78894.1| hypothetical protein (mitochondrion) [Vicia faba]... 119 2e-24 ref|YP_009049820.1| hypothetical protein (mitochondrion) [Capsic... 104 5e-22 ref|XP_010087758.1| hypothetical protein L484_008955 [Morus nota... 75 4e-14 ref|XP_010313185.1| PREDICTED: uncharacterized protein LOC101264... 60 1e-06 ref|XP_002531802.1| conserved hypothetical protein [Ricinus comm... 60 1e-06 >gb|AGC78894.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803272|gb|AGC79007.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 602 Score = 119 bits (297), Expect = 2e-24 Identities = 57/58 (98%), Positives = 57/58 (98%) Frame = -3 Query: 175 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGEHF*SALVNGSPSIKQERSGYSHGG 2 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGEHF SALVNGSPSIKQERSGYSHGG Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGEHFLSALVNGSPSIKQERSGYSHGG 58 >ref|YP_009049820.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667751809|gb|AIG89896.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667752092|gb|AIG90178.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 102 Score = 104 bits (259), Expect(2) = 5e-22 Identities = 47/55 (85%), Positives = 49/55 (89%) Frame = +2 Query: 41 GASIHQRRLKVLSEPCWIVTHHTALKPNLW*IPGDKVKALDPLPHTLRCFSPPIK 205 GASIHQRRLKVLSEPCWIVTHHTALKPNLW IPGDKVK PLPHTLRC SP ++ Sbjct: 17 GASIHQRRLKVLSEPCWIVTHHTALKPNLWWIPGDKVKTQHPLPHTLRCSSPVLR 71 Score = 27.3 bits (59), Expect(2) = 5e-22 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +3 Query: 3 PPWE*PLLSCLIEG 44 PPWE PL SCLI G Sbjct: 4 PPWEEPLPSCLIGG 17 >ref|XP_010087758.1| hypothetical protein L484_008955 [Morus notabilis] gi|587839116|gb|EXB29791.1| hypothetical protein L484_008955 [Morus notabilis] Length = 69 Score = 75.1 bits (183), Expect(2) = 4e-14 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = +2 Query: 41 GASIHQRRLKVLSEPCWIVTHHTALKPNLW*IPGDKV 151 GASIHQRRLKVLSEPCWIVTHHTALKPNLW IP D + Sbjct: 17 GASIHQRRLKVLSEPCWIVTHHTALKPNLWWIPADVI 53 Score = 30.0 bits (66), Expect(2) = 4e-14 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 PPWE*PLLSCLIEG 44 PPWE PLLSCLI G Sbjct: 4 PPWEEPLLSCLIVG 17 >ref|XP_010313185.1| PREDICTED: uncharacterized protein LOC101264997, partial [Solanum lycopersicum] Length = 294 Score = 60.1 bits (144), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 175 MGQRIKRFDFVSRDSPQVGFESRVMGDYPAR 83 MGQR+ RFDFVSRD PQVGF+SRVMGDYPAR Sbjct: 1 MGQRMLRFDFVSRDPPQVGFQSRVMGDYPAR 31 >ref|XP_002531802.1| conserved hypothetical protein [Ricinus communis] gi|223528568|gb|EEF30590.1| conserved hypothetical protein [Ricinus communis] Length = 72 Score = 59.7 bits (143), Expect = 1e-06 Identities = 34/59 (57%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = +2 Query: 32 LDRGASIHQRRLKVLSEPCWIVTHHTALKPNLW*-IPGDKVKALDPLPHTLRCFSPPIK 205 L RG SI Q RLKVL EPC I+T++T GD VKALDPLPHTL+ S PIK Sbjct: 14 LTRGPSIQQCRLKVLCEPCRIITYYTTHSSQTCDGSQGDNVKALDPLPHTLKGSSTPIK 72