BLASTX nr result
ID: Wisteria21_contig00029295
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00029295 (831 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH50044.1| hypothetical protein GLYMA_07G196600 [Glycine max] 58 7e-06 >gb|KRH50044.1| hypothetical protein GLYMA_07G196600 [Glycine max] Length = 59 Score = 58.2 bits (139), Expect = 7e-06 Identities = 35/60 (58%), Positives = 40/60 (66%), Gaps = 6/60 (10%) Frame = +1 Query: 16 MPKEICPSESVE*L*----NGDIFIEDDKSYFHIYFYC--QESRQRKLSNFCQRRFAQYS 177 MPKEICP E VE L NG+IF + K+ HI+ Q S Q+KLSNFCQRRFAQYS Sbjct: 1 MPKEICPQERVEFLEKLPLNGNIF-KKAKNVLHIFLLLGIQVSNQKKLSNFCQRRFAQYS 59