BLASTX nr result
ID: Wisteria21_contig00029217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00029217 (390 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003535790.1| PREDICTED: nucleolar complex protein 2 homol... 51 1e-10 ref|XP_006589789.1| PREDICTED: nucleolar complex protein 2 homol... 51 1e-10 ref|XP_006589790.1| PREDICTED: nucleolar complex protein 2 homol... 51 1e-10 >ref|XP_003535790.1| PREDICTED: nucleolar complex protein 2 homolog isoform X1 [Glycine max] Length = 122 Score = 51.2 bits (121), Expect(2) = 1e-10 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = -2 Query: 296 PATISVSRFLIQGTWTQQMIQRGMWTERIV*DEGAEK 186 P + +RFLIQ TWTQ+MIQRG+W ER V DEGA K Sbjct: 23 PPPPASNRFLIQPTWTQKMIQRGIWMERTVLDEGAAK 59 Score = 41.2 bits (95), Expect(2) = 1e-10 Identities = 17/19 (89%), Positives = 19/19 (100%) Frame = -1 Query: 123 DPEFFEFLKEHDQELLQFS 67 DPEF+EFLKEHD+ELLQFS Sbjct: 81 DPEFYEFLKEHDKELLQFS 99 >ref|XP_006589789.1| PREDICTED: nucleolar complex protein 2 homolog isoform X2 [Glycine max] Length = 107 Score = 51.2 bits (121), Expect(2) = 1e-10 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = -2 Query: 296 PATISVSRFLIQGTWTQQMIQRGMWTERIV*DEGAEK 186 P + +RFLIQ TWTQ+MIQRG+W ER V DEGA K Sbjct: 23 PPPPASNRFLIQPTWTQKMIQRGIWMERTVLDEGAAK 59 Score = 41.2 bits (95), Expect(2) = 1e-10 Identities = 17/19 (89%), Positives = 19/19 (100%) Frame = -1 Query: 123 DPEFFEFLKEHDQELLQFS 67 DPEF+EFLKEHD+ELLQFS Sbjct: 81 DPEFYEFLKEHDKELLQFS 99 >ref|XP_006589790.1| PREDICTED: nucleolar complex protein 2 homolog isoform X3 [Glycine max] Length = 105 Score = 51.2 bits (121), Expect(2) = 1e-10 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = -2 Query: 296 PATISVSRFLIQGTWTQQMIQRGMWTERIV*DEGAEK 186 P + +RFLIQ TWTQ+MIQRG+W ER V DEGA K Sbjct: 23 PPPPASNRFLIQPTWTQKMIQRGIWMERTVLDEGAAK 59 Score = 41.2 bits (95), Expect(2) = 1e-10 Identities = 17/19 (89%), Positives = 19/19 (100%) Frame = -1 Query: 123 DPEFFEFLKEHDQELLQFS 67 DPEF+EFLKEHD+ELLQFS Sbjct: 81 DPEFYEFLKEHDKELLQFS 99