BLASTX nr result
ID: Wisteria21_contig00029206
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00029206 (209 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002539036.1| conserved hypothetical protein [Ricinus comm... 65 3e-08 ref|XP_010112425.1| hypothetical protein L484_006110 [Morus nota... 59 1e-06 >ref|XP_002539036.1| conserved hypothetical protein [Ricinus communis] gi|223509128|gb|EEF23348.1| conserved hypothetical protein, partial [Ricinus communis] Length = 76 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 191 EREPGRWKSQGGPGHLTEMEGFSPIREGPLK 99 EREPGRWKSQG PGHLTEMEGFSPI EGP+K Sbjct: 46 EREPGRWKSQGRPGHLTEMEGFSPIIEGPMK 76 >ref|XP_010112425.1| hypothetical protein L484_006110 [Morus notabilis] gi|587947244|gb|EXC33546.1| hypothetical protein L484_006110 [Morus notabilis] Length = 201 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 188 REPGRWKSQGGPGHLTEMEGFSPIREGPLK 99 RE G WKSQG PGHLTEMEGFSPIREGP+K Sbjct: 172 RELGWWKSQGRPGHLTEMEGFSPIREGPMK 201