BLASTX nr result
ID: Wisteria21_contig00029063
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00029063 (590 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013461774.1| ubiquitin system component CUE protein [Medi... 41 4e-06 ref|XP_013461776.1| ubiquitin system component CUE protein [Medi... 41 4e-06 >ref|XP_013461774.1| ubiquitin system component CUE protein [Medicago truncatula] gi|657395535|gb|KEH35809.1| ubiquitin system component CUE protein [Medicago truncatula] Length = 915 Score = 41.2 bits (95), Expect(2) = 4e-06 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -1 Query: 581 NHYRKDRAMKKHFSGLSG 528 NHYRKD+AMKKHFSGLSG Sbjct: 844 NHYRKDQAMKKHFSGLSG 861 Score = 36.2 bits (82), Expect(2) = 4e-06 Identities = 17/40 (42%), Positives = 24/40 (60%) Frame = -2 Query: 421 SFLRGLSSMRCIDTVHYTSSSDISPLLGKVYHGCSRDFHV 302 ++ G+ + TV + S + L GKVY+GCSRDFHV Sbjct: 867 TYRHGVLLFWLLPTVFSSLGSMANTLTGKVYYGCSRDFHV 906 >ref|XP_013461776.1| ubiquitin system component CUE protein [Medicago truncatula] gi|657395537|gb|KEH35811.1| ubiquitin system component CUE protein [Medicago truncatula] Length = 724 Score = 41.2 bits (95), Expect(2) = 4e-06 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -1 Query: 581 NHYRKDRAMKKHFSGLSG 528 NHYRKD+AMKKHFSGLSG Sbjct: 653 NHYRKDQAMKKHFSGLSG 670 Score = 36.2 bits (82), Expect(2) = 4e-06 Identities = 17/40 (42%), Positives = 24/40 (60%) Frame = -2 Query: 421 SFLRGLSSMRCIDTVHYTSSSDISPLLGKVYHGCSRDFHV 302 ++ G+ + TV + S + L GKVY+GCSRDFHV Sbjct: 676 TYRHGVLLFWLLPTVFSSLGSMANTLTGKVYYGCSRDFHV 715