BLASTX nr result
ID: Wisteria21_contig00028576
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00028576 (763 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004492340.1| PREDICTED: pentatricopeptide repeat-containi... 90 2e-15 ref|XP_003623067.2| PPR containing plant-like protein, putative ... 87 2e-14 gb|KHN40309.1| Pentatricopeptide repeat-containing protein, mito... 79 3e-12 ref|XP_006583587.1| PREDICTED: pentatricopeptide repeat-containi... 79 3e-12 gb|KHN13974.1| Pentatricopeptide repeat-containing protein, mito... 75 6e-11 ref|XP_014517015.1| PREDICTED: pentatricopeptide repeat-containi... 71 7e-10 gb|KOM37994.1| hypothetical protein LR48_Vigan03g137600 [Vigna a... 70 1e-09 ref|XP_007140308.1| hypothetical protein PHAVU_008G101200g [Phas... 69 5e-09 >ref|XP_004492340.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Cicer arietinum] Length = 545 Score = 89.7 bits (221), Expect = 2e-15 Identities = 43/55 (78%), Positives = 50/55 (90%) Frame = -3 Query: 761 LLLSGGMKQEIDKLVSLAMSTGVDGDLWNLFVKPVVGNVDGSAAELGRILIENAV 597 LLLSGGMKQEI+K+VS+A+STGVD D+WNLFVKPVV NVD AAE+ RIL+ENAV Sbjct: 491 LLLSGGMKQEINKVVSMAISTGVDADMWNLFVKPVVDNVDSGAAEIDRILLENAV 545 >ref|XP_003623067.2| PPR containing plant-like protein, putative [Medicago truncatula] gi|657378065|gb|AES79285.2| PPR containing plant-like protein, putative [Medicago truncatula] Length = 535 Score = 86.7 bits (213), Expect = 2e-14 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = -3 Query: 761 LLLSGGMKQEIDKLVSLAMSTGVDGDLWNLFVKPVVGNVDGSAAELGRILIENA 600 +LL GGMKQEI+K+VSLAMSTGVD DLWN+FVKPVVGN +G AEL RIL+ENA Sbjct: 481 ILLLGGMKQEINKVVSLAMSTGVDADLWNIFVKPVVGNDNGGEAELDRILLENA 534 >gb|KHN40309.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 512 Score = 79.0 bits (193), Expect = 3e-12 Identities = 38/53 (71%), Positives = 47/53 (88%) Frame = -3 Query: 755 LSGGMKQEIDKLVSLAMSTGVDGDLWNLFVKPVVGNVDGSAAELGRILIENAV 597 LSGG K+EIDK+V LAM+TGVDG+ W+LF+K VVGN+DG+A+EL RIL ENAV Sbjct: 460 LSGGKKEEIDKVVLLAMTTGVDGEWWDLFLKLVVGNLDGNASELDRILTENAV 512 >ref|XP_006583587.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like isoform X1 [Glycine max] gi|571466177|ref|XP_006583588.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like isoform X2 [Glycine max] gi|947100600|gb|KRH49092.1| hypothetical protein GLYMA_07G131700 [Glycine max] Length = 529 Score = 79.0 bits (193), Expect = 3e-12 Identities = 38/53 (71%), Positives = 47/53 (88%) Frame = -3 Query: 755 LSGGMKQEIDKLVSLAMSTGVDGDLWNLFVKPVVGNVDGSAAELGRILIENAV 597 LSGG K+EIDK+V LAM+TGVDG+ W+LF+K VVGN+DG+A+EL RIL ENAV Sbjct: 477 LSGGKKEEIDKVVLLAMTTGVDGEWWDLFLKLVVGNLDGNASELDRILTENAV 529 >gb|KHN13974.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 251 Score = 74.7 bits (182), Expect = 6e-11 Identities = 37/53 (69%), Positives = 45/53 (84%) Frame = -3 Query: 755 LSGGMKQEIDKLVSLAMSTGVDGDLWNLFVKPVVGNVDGSAAELGRILIENAV 597 LS G K+EIDK+V LAM+TGVDG+LW+LF+K VV N+DG+AAEL RIL EN V Sbjct: 199 LSEGKKEEIDKVVLLAMTTGVDGELWDLFLKLVVDNLDGNAAELDRILTENLV 251 >ref|XP_014517015.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Vigna radiata var. radiata] gi|951037854|ref|XP_014517016.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Vigna radiata var. radiata] Length = 534 Score = 71.2 bits (173), Expect = 7e-10 Identities = 36/53 (67%), Positives = 46/53 (86%) Frame = -3 Query: 755 LSGGMKQEIDKLVSLAMSTGVDGDLWNLFVKPVVGNVDGSAAELGRILIENAV 597 +SGG K+EI+K+V LAM++GVDGDLW LF+K VV N+DG+AA+L RIL ENAV Sbjct: 483 VSGGKKEEIEKVVLLAMTSGVDGDLWELFLKVVV-NLDGNAAKLDRILTENAV 534 >gb|KOM37994.1| hypothetical protein LR48_Vigan03g137600 [Vigna angularis] Length = 534 Score = 70.5 bits (171), Expect = 1e-09 Identities = 36/53 (67%), Positives = 45/53 (84%) Frame = -3 Query: 755 LSGGMKQEIDKLVSLAMSTGVDGDLWNLFVKPVVGNVDGSAAELGRILIENAV 597 +SGG K+EI+K+V LAM+ GVDGDLW LF+K VV N+DG+AA+L RIL ENAV Sbjct: 483 VSGGKKEEIEKVVLLAMTAGVDGDLWELFLKLVV-NLDGNAAKLDRILTENAV 534 >ref|XP_007140308.1| hypothetical protein PHAVU_008G101200g [Phaseolus vulgaris] gi|561013441|gb|ESW12302.1| hypothetical protein PHAVU_008G101200g [Phaseolus vulgaris] Length = 534 Score = 68.6 bits (166), Expect = 5e-09 Identities = 34/53 (64%), Positives = 44/53 (83%) Frame = -3 Query: 755 LSGGMKQEIDKLVSLAMSTGVDGDLWNLFVKPVVGNVDGSAAELGRILIENAV 597 +SGG K+EI+K+V LAM+TGVDG LW +F+K +VGN+DG+AA L RIL EN V Sbjct: 483 VSGGKKEEIEKVVLLAMTTGVDGGLWGIFLK-LVGNLDGNAAMLDRILTENVV 534