BLASTX nr result
ID: Wisteria21_contig00027360
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00027360 (496 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007159279.1| hypothetical protein PHAVU_002G224600g [Phas... 61 4e-07 gb|KOM58079.1| hypothetical protein LR48_Vigan11g111300 [Vigna a... 56 9e-06 >ref|XP_007159279.1| hypothetical protein PHAVU_002G224600g [Phaseolus vulgaris] gi|561032694|gb|ESW31273.1| hypothetical protein PHAVU_002G224600g [Phaseolus vulgaris] Length = 1304 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/40 (72%), Positives = 33/40 (82%), Gaps = 2/40 (5%) Frame = -2 Query: 114 MANEDVDFSELFPV--GGDDMFYIDIQTIMKVLDEGDDCD 1 MA+E+VDFS+LFP G DDMFYIDI T+ KVLDE DDCD Sbjct: 1 MADEEVDFSKLFPGDDGDDDMFYIDIHTVQKVLDEDDDCD 40 >gb|KOM58079.1| hypothetical protein LR48_Vigan11g111300 [Vigna angularis] Length = 102 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/40 (67%), Positives = 31/40 (77%), Gaps = 2/40 (5%) Frame = -2 Query: 114 MANEDVDFSELF--PVGGDDMFYIDIQTIMKVLDEGDDCD 1 MAN+DVDFS+LF DDMFYID+ T+ KVLDE DDCD Sbjct: 1 MANDDVDFSKLFNGDDDDDDMFYIDMNTVQKVLDEDDDCD 40