BLASTX nr result
ID: Wisteria21_contig00027136
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00027136 (351 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012572688.1| PREDICTED: putative amidase C869.01 [Cicer a... 67 5e-09 >ref|XP_012572688.1| PREDICTED: putative amidase C869.01 [Cicer arietinum] Length = 535 Score = 67.0 bits (162), Expect = 5e-09 Identities = 36/58 (62%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = -2 Query: 173 KSKNMGTTAKVSVCLVLLAVIFRGGL-VNAIDDYSEIRISEATIDDIQEAFTRNELTS 3 ++ MGT V VCLVLLAV F+G + NAID +SE ISEATI++IQEAFTR +LTS Sbjct: 14 RNPRMGTIMNVCVCLVLLAVAFKGLMNANAIDKWSEFAISEATIENIQEAFTRKDLTS 71