BLASTX nr result
ID: Wisteria21_contig00027043
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00027043 (377 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003617363.2| squalene/phytoene synthase [Medicago truncat... 94 3e-17 gb|AIT98180.1| phytoene synthase [Medicago sativa] 93 9e-17 ref|XP_004491309.1| PREDICTED: phytoene synthase 2, chloroplasti... 92 1e-16 gb|KRG98986.1| hypothetical protein GLYMA_18G111900 [Glycine max] 91 4e-16 gb|KHM99657.1| Phytoene synthase, chloroplastic [Glycine soja] 91 4e-16 ref|NP_001239926.1| uncharacterized protein LOC100776503 [Glycin... 91 4e-16 ref|XP_004516319.1| PREDICTED: phytoene synthase 2, chloroplasti... 90 6e-16 ref|XP_003532084.1| PREDICTED: phytoene synthase, chloroplastic-... 88 3e-15 ref|XP_003545292.1| PREDICTED: phytoene synthase, chloroplastic ... 87 4e-15 gb|ACU20090.1| unknown [Glycine max] 87 4e-15 gb|AFK46516.1| unknown [Lotus japonicus] 87 6e-15 gb|AFK39729.1| unknown [Lotus japonicus] 87 6e-15 emb|CBI22078.3| unnamed protein product [Vitis vinifera] 86 1e-14 ref|XP_002283193.1| PREDICTED: phytoene synthase 2, chloroplasti... 86 1e-14 ref|XP_003519534.1| PREDICTED: phytoene synthase, chloroplastic-... 86 1e-14 ref|XP_007141441.1| hypothetical protein PHAVU_008G195800g [Phas... 84 3e-14 emb|CAN70878.1| hypothetical protein VITISV_032970 [Vitis vinifera] 83 7e-14 ref|XP_013459640.1| squalene/phytoene synthase [Medicago truncat... 83 9e-14 gb|AIT18249.1| phytoene synthase 2B [Eriobotrya japonica] 82 1e-13 ref|XP_009377027.1| PREDICTED: phytoene synthase 2, chloroplasti... 82 1e-13 >ref|XP_003617363.2| squalene/phytoene synthase [Medicago truncatula] gi|657385852|gb|AET00322.2| squalene/phytoene synthase [Medicago truncatula] Length = 388 Score = 94.4 bits (233), Expect = 3e-17 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -3 Query: 375 YRQILDAIEANDYDNFTKRAYVGKVKKLLSLPAAYGIAFLGPKKLTKLIMR 223 YRQILD+IEANDY+NFTKRAYVGKV KLLSLPAAYG+A LGPKKLTKL MR Sbjct: 338 YRQILDSIEANDYNNFTKRAYVGKVNKLLSLPAAYGVALLGPKKLTKLFMR 388 >gb|AIT98180.1| phytoene synthase [Medicago sativa] Length = 388 Score = 92.8 bits (229), Expect = 9e-17 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = -3 Query: 375 YRQILDAIEANDYDNFTKRAYVGKVKKLLSLPAAYGIAFLGPKKLTKLIMR 223 YRQILD+IEANDY+NFTKRAYVGKV KLLSLPAAYG A LGPKKLTKL MR Sbjct: 338 YRQILDSIEANDYNNFTKRAYVGKVNKLLSLPAAYGTALLGPKKLTKLFMR 388 >ref|XP_004491309.1| PREDICTED: phytoene synthase 2, chloroplastic-like [Cicer arietinum] Length = 392 Score = 92.4 bits (228), Expect = 1e-16 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = -3 Query: 375 YRQILDAIEANDYDNFTKRAYVGKVKKLLSLPAAYGIAFLGPKKLTKLIMR 223 YRQILD+IEANDYDNFTKRAYVGKV KLLSLPAAYGIA LGP+ LTK +MR Sbjct: 342 YRQILDSIEANDYDNFTKRAYVGKVNKLLSLPAAYGIALLGPQNLTKFLMR 392 >gb|KRG98986.1| hypothetical protein GLYMA_18G111900 [Glycine max] Length = 311 Score = 90.5 bits (223), Expect = 4e-16 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = -3 Query: 375 YRQILDAIEANDYDNFTKRAYVGKVKKLLSLPAAYGIAFLGPKKLTKLIMR 223 YRQILD+IEANDY+NFTKRAYVGKVKKLLSLPAAYG A LGP+KLTK++ R Sbjct: 259 YRQILDSIEANDYNNFTKRAYVGKVKKLLSLPAAYGRALLGPQKLTKMVTR 309 >gb|KHM99657.1| Phytoene synthase, chloroplastic [Glycine soja] Length = 422 Score = 90.5 bits (223), Expect = 4e-16 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = -3 Query: 375 YRQILDAIEANDYDNFTKRAYVGKVKKLLSLPAAYGIAFLGPKKLTKLIMR 223 YRQILD+IEANDY+NFTKRAYVGKVKKLLSLPAAYG A LGP+KLTK++ R Sbjct: 370 YRQILDSIEANDYNNFTKRAYVGKVKKLLSLPAAYGRALLGPQKLTKMVTR 420 >ref|NP_001239926.1| uncharacterized protein LOC100776503 [Glycine max] gi|255636401|gb|ACU18539.1| unknown [Glycine max] gi|734396807|gb|KHN29819.1| Phytoene synthase, chloroplastic [Glycine soja] gi|947049456|gb|KRG98984.1| hypothetical protein GLYMA_18G111900 [Glycine max] Length = 396 Score = 90.5 bits (223), Expect = 4e-16 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = -3 Query: 375 YRQILDAIEANDYDNFTKRAYVGKVKKLLSLPAAYGIAFLGPKKLTKLIMR 223 YRQILD+IEANDY+NFTKRAYVGKVKKLLSLPAAYG A LGP+KLTK++ R Sbjct: 344 YRQILDSIEANDYNNFTKRAYVGKVKKLLSLPAAYGRALLGPQKLTKMVTR 394 >ref|XP_004516319.1| PREDICTED: phytoene synthase 2, chloroplastic-like [Cicer arietinum] Length = 393 Score = 90.1 bits (222), Expect = 6e-16 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = -3 Query: 375 YRQILDAIEANDYDNFTKRAYVGKVKKLLSLPAAYGIAFLGPKKLTKLIMR 223 YRQILD+IEANDY+NFTKRAYVGK KKLLSLP AYG AFLGP+KLTK+I R Sbjct: 343 YRQILDSIEANDYNNFTKRAYVGKAKKLLSLPVAYGRAFLGPQKLTKMITR 393 >ref|XP_003532084.1| PREDICTED: phytoene synthase, chloroplastic-like [Glycine max] gi|947097418|gb|KRH46003.1| hypothetical protein GLYMA_08G306200 [Glycine max] Length = 396 Score = 87.8 bits (216), Expect = 3e-15 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = -3 Query: 375 YRQILDAIEANDYDNFTKRAYVGKVKKLLSLPAAYGIAFLGPKKLTKLIMR 223 Y QILD+IEANDY+NFTKRAYVGKVKKLLSLPAAYG A LGP+KLTK++ R Sbjct: 344 YGQILDSIEANDYNNFTKRAYVGKVKKLLSLPAAYGRALLGPQKLTKMVTR 394 >ref|XP_003545292.1| PREDICTED: phytoene synthase, chloroplastic [Glycine max] gi|734348808|gb|KHN11991.1| Phytoene synthase, chloroplastic [Glycine soja] gi|947065376|gb|KRH14519.1| hypothetical protein GLYMA_14G031200 [Glycine max] Length = 400 Score = 87.4 bits (215), Expect = 4e-15 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = -3 Query: 375 YRQILDAIEANDYDNFTKRAYVGKVKKLLSLPAAYGIAFLGPKKLTKLIMR 223 YRQILD+IEANDY+NFTKRAYVGKVKKLLSLP AYG + LGP+K TK++ R Sbjct: 350 YRQILDSIEANDYNNFTKRAYVGKVKKLLSLPTAYGFSLLGPQKFTKMVRR 400 >gb|ACU20090.1| unknown [Glycine max] Length = 219 Score = 87.4 bits (215), Expect = 4e-15 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = -3 Query: 375 YRQILDAIEANDYDNFTKRAYVGKVKKLLSLPAAYGIAFLGPKKLTKLIMR 223 YRQILD+IEANDY+NFTKRAYVGKVKKLLSLP AYG + LGP+K TK++ R Sbjct: 169 YRQILDSIEANDYNNFTKRAYVGKVKKLLSLPTAYGFSLLGPQKFTKMVRR 219 >gb|AFK46516.1| unknown [Lotus japonicus] Length = 393 Score = 86.7 bits (213), Expect = 6e-15 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = -3 Query: 375 YRQILDAIEANDYDNFTKRAYVGKVKKLLSLPAAYGIAFLGPKKLTKLIMR 223 YRQILD+IEANDY+NFTKRAYVGK KKLLSLPAAYG A LGP+ LTK++ R Sbjct: 343 YRQILDSIEANDYNNFTKRAYVGKAKKLLSLPAAYGRAILGPQMLTKMVAR 393 >gb|AFK39729.1| unknown [Lotus japonicus] Length = 219 Score = 86.7 bits (213), Expect = 6e-15 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = -3 Query: 375 YRQILDAIEANDYDNFTKRAYVGKVKKLLSLPAAYGIAFLGPKKLTKLIMR 223 YRQILD+IEANDY+NFTKRAYVGK KKLLSLPAAYG A LGP+ LTK++ R Sbjct: 169 YRQILDSIEANDYNNFTKRAYVGKAKKLLSLPAAYGRAILGPQMLTKMVAR 219 >emb|CBI22078.3| unnamed protein product [Vitis vinifera] Length = 303 Score = 85.9 bits (211), Expect = 1e-14 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = -3 Query: 375 YRQILDAIEANDYDNFTKRAYVGKVKKLLSLPAAYGIAFLGPKKLTKLIMR 223 YRQILDAIEANDY+NFTKRAYVGK+KKL+SLP AYG A +GP KLT+L+ R Sbjct: 253 YRQILDAIEANDYNNFTKRAYVGKLKKLVSLPIAYGSALMGPSKLTQLVRR 303 >ref|XP_002283193.1| PREDICTED: phytoene synthase 2, chloroplastic [Vitis vinifera] Length = 396 Score = 85.9 bits (211), Expect = 1e-14 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = -3 Query: 375 YRQILDAIEANDYDNFTKRAYVGKVKKLLSLPAAYGIAFLGPKKLTKLIMR 223 YRQILDAIEANDY+NFTKRAYVGK+KKL+SLP AYG A +GP KLT+L+ R Sbjct: 346 YRQILDAIEANDYNNFTKRAYVGKLKKLVSLPIAYGSALMGPSKLTQLVRR 396 >ref|XP_003519534.1| PREDICTED: phytoene synthase, chloroplastic-like [Glycine max] gi|734416469|gb|KHN38348.1| Phytoene synthase, chloroplastic [Glycine soja] gi|947125401|gb|KRH73607.1| hypothetical protein GLYMA_02G283400 [Glycine max] Length = 399 Score = 85.5 bits (210), Expect = 1e-14 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = -3 Query: 375 YRQILDAIEANDYDNFTKRAYVGKVKKLLSLPAAYGIAFLGPKKLTKLIMR 223 YRQILD+IEANDY+NFTKRAYVGKVKKLLSLP AYG + LGP+K K++ R Sbjct: 349 YRQILDSIEANDYNNFTKRAYVGKVKKLLSLPTAYGFSLLGPQKFAKMVRR 399 >ref|XP_007141441.1| hypothetical protein PHAVU_008G195800g [Phaseolus vulgaris] gi|561014574|gb|ESW13435.1| hypothetical protein PHAVU_008G195800g [Phaseolus vulgaris] Length = 399 Score = 84.3 bits (207), Expect = 3e-14 Identities = 40/52 (76%), Positives = 47/52 (90%), Gaps = 1/52 (1%) Frame = -3 Query: 375 YRQILDAIEANDYDNFTKRAYVGKVKKLLSLPAAYGIAFLGPKK-LTKLIMR 223 YRQILD+IEANDY+NFTKRAYVGK KKLLSLP AYG++FLGP+K TK++ R Sbjct: 348 YRQILDSIEANDYNNFTKRAYVGKAKKLLSLPVAYGLSFLGPQKNFTKMVKR 399 >emb|CAN70878.1| hypothetical protein VITISV_032970 [Vitis vinifera] Length = 428 Score = 83.2 bits (204), Expect = 7e-14 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = -3 Query: 375 YRQILDAIEANDYDNFTKRAYVGKVKKLLSLPAAYGIAFLGPKKLTKL 232 YRQILDAIEANDY+NFTKRAYVGK+KKL+SLP AYG A +GP KLT+L Sbjct: 346 YRQILDAIEANDYNNFTKRAYVGKLKKLVSLPIAYGSALMGPSKLTQL 393 >ref|XP_013459640.1| squalene/phytoene synthase [Medicago truncatula] gi|657392764|gb|KEH33671.1| squalene/phytoene synthase [Medicago truncatula] Length = 395 Score = 82.8 bits (203), Expect = 9e-14 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = -3 Query: 375 YRQILDAIEANDYDNFTKRAYVGKVKKLLSLPAAYGIAFLGPKKLTKLIMR 223 YRQILD+IEANDY+NFTKRAYVGK KKLLSLP A+GIA GP+KL K+ R Sbjct: 345 YRQILDSIEANDYNNFTKRAYVGKAKKLLSLPVAFGIATFGPQKLAKMTTR 395 >gb|AIT18249.1| phytoene synthase 2B [Eriobotrya japonica] Length = 396 Score = 82.4 bits (202), Expect = 1e-13 Identities = 40/50 (80%), Positives = 42/50 (84%) Frame = -3 Query: 375 YRQILDAIEANDYDNFTKRAYVGKVKKLLSLPAAYGIAFLGPKKLTKLIM 226 YRQILDAIEAN YDNFTKRAYVGK KKL SLP AYG A LGP KLTK ++ Sbjct: 345 YRQILDAIEANGYDNFTKRAYVGKAKKLASLPVAYGRAILGPSKLTKQLV 394 >ref|XP_009377027.1| PREDICTED: phytoene synthase 2, chloroplastic-like [Pyrus x bretschneideri] Length = 396 Score = 82.4 bits (202), Expect = 1e-13 Identities = 40/50 (80%), Positives = 42/50 (84%) Frame = -3 Query: 375 YRQILDAIEANDYDNFTKRAYVGKVKKLLSLPAAYGIAFLGPKKLTKLIM 226 YRQILDAIEAN YDNFTKRAYVGK KKL SLP AYG A LGP KLTK ++ Sbjct: 345 YRQILDAIEANGYDNFTKRAYVGKAKKLASLPVAYGRAILGPSKLTKQLV 394