BLASTX nr result
ID: Wisteria21_contig00026535
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00026535 (233 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001237004.1| uncharacterized protein LOC100500626 [Glycin... 80 5e-13 gb|KHN06645.1| Putative calcium-binding protein CML19 [Glycine s... 75 1e-11 ref|XP_006579175.1| PREDICTED: probable calcium-binding protein ... 75 1e-11 ref|XP_003549848.1| PREDICTED: putative calcium-binding protein ... 75 2e-11 gb|KRH62839.1| hypothetical protein GLYMA_04G136200 [Glycine max] 75 3e-11 gb|KRH30083.1| hypothetical protein GLYMA_11G157100 [Glycine max] 74 3e-11 ref|XP_003538266.2| PREDICTED: calmodulin-like protein 12-like [... 74 3e-11 ref|XP_006579596.1| PREDICTED: putative calcium-binding protein ... 74 3e-11 gb|KRH30084.1| hypothetical protein GLYMA_11G157200 [Glycine max] 74 6e-11 gb|KHN14097.1| Putative calcium-binding protein CML31 [Glycine s... 74 6e-11 gb|KHN21326.1| Putative calcium-binding protein CML19 [Glycine s... 73 7e-11 gb|KHN34410.1| Putative calcium-binding protein CML31 [Glycine s... 73 1e-10 gb|KHN05761.1| Putative calcium-binding protein CML19 [Glycine s... 72 2e-10 ref|NP_001235017.1| uncharacterized protein LOC100526852 [Glycin... 72 2e-10 gb|KHN21325.1| Putative calcium-binding protein CML19 [Glycine s... 71 4e-10 ref|XP_004515822.1| PREDICTED: putative calcium-binding protein ... 68 2e-09 ref|XP_008239450.1| PREDICTED: putative calcium-binding protein ... 66 9e-09 ref|XP_006581875.1| PREDICTED: calcium-binding protein CML38-lik... 66 1e-08 gb|AFK45118.1| unknown [Lotus japonicus] 66 1e-08 ref|XP_007148928.1| hypothetical protein PHAVU_005G026000g [Phas... 65 2e-08 >ref|NP_001237004.1| uncharacterized protein LOC100500626 [Glycine max] gi|255630782|gb|ACU15752.1| unknown [Glycine max] Length = 143 Score = 80.5 bits (197), Expect = 5e-13 Identities = 38/45 (84%), Positives = 44/45 (97%) Frame = +1 Query: 1 ASLSNNSPPIMPTRFLSSDGEILPSPSSSKYLRTRSNSMFLLISQ 135 ASL+NN+PPIMP+RFLSSDGEILPSPSSSKYLRTRSNS+F LI++ Sbjct: 97 ASLNNNTPPIMPSRFLSSDGEILPSPSSSKYLRTRSNSVFTLITE 141 >gb|KHN06645.1| Putative calcium-binding protein CML19 [Glycine soja] gi|947114538|gb|KRH62840.1| hypothetical protein GLYMA_04G136300 [Glycine max] Length = 144 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 128 MRRNIEFERVLRYFDEDGDGKISPSELRNRVGMMGGELLLKE 3 MR N EFERVL+YF+EDGDGKISPSELRNR+GMMGGELL K+ Sbjct: 1 MRVNTEFERVLKYFNEDGDGKISPSELRNRLGMMGGELLFKD 42 >ref|XP_006579175.1| PREDICTED: probable calcium-binding protein CML25/26-like [Glycine max] Length = 139 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 128 MRRNIEFERVLRYFDEDGDGKISPSELRNRVGMMGGELLLKE 3 MR N EFERVL+YF+EDGDGKISPSELRNR+GMMGGELL K+ Sbjct: 1 MRVNTEFERVLKYFNEDGDGKISPSELRNRLGMMGGELLFKD 42 >ref|XP_003549848.1| PREDICTED: putative calcium-binding protein CML19-like [Glycine max] gi|947054492|gb|KRH03945.1| hypothetical protein GLYMA_17G128900 [Glycine max] Length = 140 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -1 Query: 128 MRRNIEFERVLRYFDEDGDGKISPSELRNRVGMMGGELLLKE 3 M R E+ERVLRYFDEDGDGKISPSELRNR+ MMGGE++LKE Sbjct: 1 MMRGAEYERVLRYFDEDGDGKISPSELRNRIAMMGGEVMLKE 42 >gb|KRH62839.1| hypothetical protein GLYMA_04G136200 [Glycine max] Length = 141 Score = 74.7 bits (182), Expect = 3e-11 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -1 Query: 128 MRRNIEFERVLRYFDEDGDGKISPSELRNRVGMMGGELLLKE 3 MR N EFERVL+YFDEDGDGKISPSELRNR+GMMGG LL K+ Sbjct: 1 MRVNTEFERVLKYFDEDGDGKISPSELRNRLGMMGGVLLFKD 42 >gb|KRH30083.1| hypothetical protein GLYMA_11G157100 [Glycine max] Length = 141 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -1 Query: 128 MRRNIEFERVLRYFDEDGDGKISPSELRNRVGMMGGELLLKE 3 MR N EFERVL+YFDEDGDGKISP ELRNR+GM+GGELL K+ Sbjct: 1 MRMNTEFERVLKYFDEDGDGKISPCELRNRLGMIGGELLAKD 42 >ref|XP_003538266.2| PREDICTED: calmodulin-like protein 12-like [Glycine max] Length = 272 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -1 Query: 128 MRRNIEFERVLRYFDEDGDGKISPSELRNRVGMMGGELLLKE 3 MR N EFERVL+YFDEDGDGKISP ELRNR+GM+GGELL K+ Sbjct: 1 MRMNTEFERVLKYFDEDGDGKISPCELRNRLGMIGGELLAKD 42 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 110 FERVLRYFDEDGDGKISPSELRNRVGMMGGELLLKE 3 FERVL+YFDEDGDGKISP ELRNR+GM+GGELL K+ Sbjct: 138 FERVLKYFDEDGDGKISPCELRNRLGMIGGELLTKD 173 >ref|XP_006579596.1| PREDICTED: putative calcium-binding protein CML19-like [Glycine max] gi|947108892|gb|KRH57218.1| hypothetical protein GLYMA_05G047100 [Glycine max] Length = 140 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -1 Query: 128 MRRNIEFERVLRYFDEDGDGKISPSELRNRVGMMGGELLLKE 3 M R E+ERVLRYFDEDGDGKISPSELRNR+ MMGGE++LKE Sbjct: 1 MMRGEEYERVLRYFDEDGDGKISPSELRNRISMMGGEVMLKE 42 >gb|KRH30084.1| hypothetical protein GLYMA_11G157200 [Glycine max] Length = 141 Score = 73.6 bits (179), Expect = 6e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -1 Query: 128 MRRNIEFERVLRYFDEDGDGKISPSELRNRVGMMGGELLLKE 3 MR N EFERVL+YFDEDGDGKISP ELRNR+GM+GGELL K+ Sbjct: 1 MRVNTEFERVLKYFDEDGDGKISPCELRNRLGMIGGELLTKD 42 >gb|KHN14097.1| Putative calcium-binding protein CML31 [Glycine soja] Length = 139 Score = 73.6 bits (179), Expect = 6e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -1 Query: 122 RNIEFERVLRYFDEDGDGKISPSELRNRVGMMGGELLLKE 3 R E+ERVLRYFDEDGDGKISPSELRNR+ MMGGE++LKE Sbjct: 2 RGAEYERVLRYFDEDGDGKISPSELRNRIAMMGGEVMLKE 41 >gb|KHN21326.1| Putative calcium-binding protein CML19 [Glycine soja] Length = 141 Score = 73.2 bits (178), Expect = 7e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -1 Query: 128 MRRNIEFERVLRYFDEDGDGKISPSELRNRVGMMGGELLLKE 3 MR N EFERVL+YFDEDGDGKISP ELRNR+GM+GGELL K+ Sbjct: 1 MRVNTEFERVLKYFDEDGDGKISPCELRNRLGMIGGELLSKD 42 >gb|KHN34410.1| Putative calcium-binding protein CML31 [Glycine soja] Length = 139 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -1 Query: 122 RNIEFERVLRYFDEDGDGKISPSELRNRVGMMGGELLLKE 3 R E+ERVLRYFDEDGDGKISPSELRNR+ MMGGE++LKE Sbjct: 2 RGEEYERVLRYFDEDGDGKISPSELRNRISMMGGEVMLKE 41 >gb|KHN05761.1| Putative calcium-binding protein CML19 [Glycine soja] gi|947114541|gb|KRH62843.1| hypothetical protein GLYMA_04G136600 [Glycine max] Length = 141 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -1 Query: 128 MRRNIEFERVLRYFDEDGDGKISPSELRNRVGMMGGELLLKE 3 MR + EFERVL+YFDEDGDGKISPSELRNR+ MMGGELL K+ Sbjct: 1 MRVSAEFERVLKYFDEDGDGKISPSELRNRLCMMGGELLFKD 42 >ref|NP_001235017.1| uncharacterized protein LOC100526852 [Glycine max] gi|255630988|gb|ACU15858.1| unknown [Glycine max] Length = 141 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -1 Query: 128 MRRNIEFERVLRYFDEDGDGKISPSELRNRVGMMGGELLLKE 3 MR + EFERVL+YFDEDGDGKISPSELRNR+ MMGGELL K+ Sbjct: 1 MRVSAEFERVLKYFDEDGDGKISPSELRNRLCMMGGELLFKD 42 >gb|KHN21325.1| Putative calcium-binding protein CML19 [Glycine soja] Length = 139 Score = 70.9 bits (172), Expect = 4e-10 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 119 NIEFERVLRYFDEDGDGKISPSELRNRVGMMGGELLLKE 3 N EFERVL+YFDEDGDGKISP ELRNR+GM+GGELL K+ Sbjct: 2 NTEFERVLKYFDEDGDGKISPCELRNRLGMIGGELLAKD 40 >ref|XP_004515822.1| PREDICTED: putative calcium-binding protein CML19 [Cicer arietinum] Length = 140 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -1 Query: 128 MRRNIEFERVLRYFDEDGDGKISPSELRNRVGMMGGELLLKE 3 MRR++EFERVL YFDEDGDGKISP ELR+R+ +GGE LLKE Sbjct: 1 MRRDMEFERVLSYFDEDGDGKISPYELRSRMTKIGGEFLLKE 42 >ref|XP_008239450.1| PREDICTED: putative calcium-binding protein CML19 [Prunus mume] Length = 140 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 128 MRRNIEFERVLRYFDEDGDGKISPSELRNRVGMMGGELLLKE 3 M+ N FERVL YFDEDGDGKISPSELR +G+MGGELL KE Sbjct: 1 MKSNGGFERVLSYFDEDGDGKISPSELRRGLGLMGGELLQKE 42 >ref|XP_006581875.1| PREDICTED: calcium-binding protein CML38-like [Glycine max] Length = 144 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/46 (63%), Positives = 39/46 (84%) Frame = -1 Query: 140 LYCDMRRNIEFERVLRYFDEDGDGKISPSELRNRVGMMGGELLLKE 3 ++ +M + + FE VLRYFDEDGDGK+SPSEL++ +GMMGGEL +KE Sbjct: 1 MHYNMGKQVGFEDVLRYFDEDGDGKVSPSELKHGLGMMGGELPMKE 46 >gb|AFK45118.1| unknown [Lotus japonicus] Length = 140 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -1 Query: 128 MRRNIEFERVLRYFDEDGDGKISPSELRNRVGMMGGELLLKE 3 M R+ EFERVL YFDEDGD KISPSEL+ R+ +MGGEL LKE Sbjct: 1 MMRDAEFERVLSYFDEDGDSKISPSELKRRLAVMGGELRLKE 42 >ref|XP_007148928.1| hypothetical protein PHAVU_005G026000g [Phaseolus vulgaris] gi|561022192|gb|ESW20922.1| hypothetical protein PHAVU_005G026000g [Phaseolus vulgaris] Length = 143 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -1 Query: 119 NIEFERVLRYFDEDGDGKISPSELRNRVGMMGGELLLKE 3 N +FERVL++FDEDGDGKISP ELR ++GMMGGEL LKE Sbjct: 5 NTDFERVLKHFDEDGDGKISPWELRKKLGMMGGELGLKE 43