BLASTX nr result
ID: Wisteria21_contig00025682
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00025682 (866 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN31119.1| Leucine-rich repeat receptor-like serine/threonin... 64 1e-07 ref|XP_003544004.1| PREDICTED: leucine-rich repeat receptor-like... 64 1e-07 ref|XP_006606695.1| PREDICTED: leucine-rich repeat receptor-like... 62 4e-07 >gb|KHN31119.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 [Glycine soja] Length = 413 Score = 64.3 bits (155), Expect = 1e-07 Identities = 32/47 (68%), Positives = 36/47 (76%), Gaps = 4/47 (8%) Frame = -1 Query: 512 DLKALLSVTNT----TPTKPFFSTLNRTVLDPCSSFSGITCFLNRPS 384 DL ALLS+ NT +PTKPFFST N T DPCSSFSG+TCFL+R S Sbjct: 31 DLNALLSIKNTLTEVSPTKPFFSTWNLTAPDPCSSFSGVTCFLSRVS 77 >ref|XP_003544004.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2-like [Glycine max] gi|947068766|gb|KRH17657.1| hypothetical protein GLYMA_13G005800 [Glycine max] Length = 412 Score = 64.3 bits (155), Expect = 1e-07 Identities = 32/47 (68%), Positives = 36/47 (76%), Gaps = 4/47 (8%) Frame = -1 Query: 512 DLKALLSVTNT----TPTKPFFSTLNRTVLDPCSSFSGITCFLNRPS 384 DL ALLS+ NT +PTKPFFST N T DPCSSFSG+TCFL+R S Sbjct: 30 DLNALLSIKNTLTEVSPTKPFFSTWNLTAPDPCSSFSGVTCFLSRVS 76 >ref|XP_006606695.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2-like [Glycine max] Length = 410 Score = 62.4 bits (150), Expect = 4e-07 Identities = 31/45 (68%), Positives = 35/45 (77%), Gaps = 4/45 (8%) Frame = -1 Query: 512 DLKALLSVTNT----TPTKPFFSTLNRTVLDPCSSFSGITCFLNR 390 DLKALLS+ NT +PTK FFST N T DPCSSFSG+TCFL+R Sbjct: 38 DLKALLSIKNTLTEVSPTKSFFSTWNLTAPDPCSSFSGVTCFLSR 82