BLASTX nr result
ID: Wisteria21_contig00025379
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00025379 (321 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN26984.1| Multiple C2 and transmembrane domain-containing p... 65 2e-08 ref|XP_006583307.1| PREDICTED: multiple C2 and transmembrane dom... 65 2e-08 ref|XP_003521097.1| PREDICTED: uncharacterized protein LOC100807... 65 2e-08 ref|XP_013444863.1| calcium-dependent lipid-binding (CaLB domain... 63 7e-08 ref|XP_010105960.1| Multiple C2 and transmembrane domain-contain... 62 1e-07 ref|XP_014516426.1| PREDICTED: protein QUIRKY-like [Vigna radiat... 62 2e-07 gb|KOM57306.1| hypothetical protein LR48_Vigan11g033900 [Vigna a... 62 2e-07 ref|XP_012083417.1| PREDICTED: multiple C2 and transmembrane dom... 62 2e-07 ref|XP_008458254.1| PREDICTED: uncharacterized protein LOC103497... 62 2e-07 ref|XP_011656335.1| PREDICTED: uncharacterized protein LOC101203... 62 2e-07 ref|XP_012574181.1| PREDICTED: LOW QUALITY PROTEIN: protein QUIR... 61 3e-07 ref|XP_002511838.1| synaptotagmin, putative [Ricinus communis] g... 61 3e-07 ref|XP_002301353.2| hypothetical protein POPTR_0002s15950g [Popu... 61 3e-07 ref|XP_008775338.1| PREDICTED: uncharacterized protein LOC103695... 61 4e-07 emb|CBI40337.3| unnamed protein product [Vitis vinifera] 60 6e-07 ref|XP_002271590.1| PREDICTED: uncharacterized protein LOC100253... 60 6e-07 emb|CAN79812.1| hypothetical protein VITISV_018822 [Vitis vinifera] 60 6e-07 gb|KNA10051.1| hypothetical protein SOVF_148000 [Spinacia oleracea] 59 1e-06 ref|XP_011092017.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 59 1e-06 ref|XP_010672799.1| PREDICTED: multiple C2 and transmembrane dom... 59 1e-06 >gb|KHN26984.1| Multiple C2 and transmembrane domain-containing protein 1 [Glycine soja] Length = 1002 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 222 MSNLKLCVEVVGAHDLMPKDGQGSCSAFVELHF 320 MSNLKL VEVVGAHDLMPKDGQGSCS +VELHF Sbjct: 1 MSNLKLGVEVVGAHDLMPKDGQGSCSTYVELHF 33 >ref|XP_006583307.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2-like isoform X1 [Glycine max] gi|571465270|ref|XP_006583308.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2-like isoform X2 [Glycine max] gi|947099675|gb|KRH48167.1| hypothetical protein GLYMA_07G072500 [Glycine max] Length = 1002 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 222 MSNLKLCVEVVGAHDLMPKDGQGSCSAFVELHF 320 MSNLKL VEVVGAHDLMPKDGQGSCS +VELHF Sbjct: 1 MSNLKLGVEVVGAHDLMPKDGQGSCSTYVELHF 33 >ref|XP_003521097.1| PREDICTED: uncharacterized protein LOC100807525 [Glycine max] gi|734391676|gb|KHN27316.1| Multiple C2 and transmembrane domain-containing protein 1 [Glycine soja] gi|947116838|gb|KRH65087.1| hypothetical protein GLYMA_03G012600 [Glycine max] Length = 1003 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 222 MSNLKLCVEVVGAHDLMPKDGQGSCSAFVELHF 320 MSNLKL VEVVGAHDLMPKDGQGSCS +VELHF Sbjct: 1 MSNLKLGVEVVGAHDLMPKDGQGSCSTYVELHF 33 >ref|XP_013444863.1| calcium-dependent lipid-binding (CaLB domain) family protein [Medicago truncatula] gi|657373128|gb|KEH18888.1| calcium-dependent lipid-binding (CaLB domain) family protein [Medicago truncatula] Length = 1003 Score = 63.2 bits (152), Expect = 7e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 222 MSNLKLCVEVVGAHDLMPKDGQGSCSAFVELHF 320 MSNLKL VEVVGAHDLMPKDG+GS SAFVELHF Sbjct: 1 MSNLKLGVEVVGAHDLMPKDGEGSASAFVELHF 33 >ref|XP_010105960.1| Multiple C2 and transmembrane domain-containing protein 1 [Morus notabilis] gi|587919371|gb|EXC06842.1| Multiple C2 and transmembrane domain-containing protein 1 [Morus notabilis] Length = 1006 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 222 MSNLKLCVEVVGAHDLMPKDGQGSCSAFVELHF 320 MSNLKL VEVVGAHDL+PKDGQGS SAFVELHF Sbjct: 1 MSNLKLGVEVVGAHDLVPKDGQGSSSAFVELHF 33 >ref|XP_014516426.1| PREDICTED: protein QUIRKY-like [Vigna radiata var. radiata] Length = 1009 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 222 MSNLKLCVEVVGAHDLMPKDGQGSCSAFVELHF 320 MSNLKL VEVVGAHDLMPKDGQGSCS +VEL F Sbjct: 1 MSNLKLGVEVVGAHDLMPKDGQGSCSTYVELQF 33 >gb|KOM57306.1| hypothetical protein LR48_Vigan11g033900 [Vigna angularis] Length = 1008 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 222 MSNLKLCVEVVGAHDLMPKDGQGSCSAFVELHF 320 MSNLKL VEVVGAHDLMPKDGQGSCS +VEL F Sbjct: 1 MSNLKLGVEVVGAHDLMPKDGQGSCSTYVELQF 33 >ref|XP_012083417.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1-like [Jatropha curcas] gi|643717020|gb|KDP28646.1| hypothetical protein JCGZ_14417 [Jatropha curcas] Length = 1025 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = +3 Query: 222 MSNLKLCVEVVGAHDLMPKDGQGSCSAFVELHF 320 MSNLKL VEVV AHDLMPKDGQGS SAFVELHF Sbjct: 1 MSNLKLGVEVVSAHDLMPKDGQGSASAFVELHF 33 >ref|XP_008458254.1| PREDICTED: uncharacterized protein LOC103497726 [Cucumis melo] gi|659116780|ref|XP_008458255.1| PREDICTED: uncharacterized protein LOC103497726 [Cucumis melo] Length = 1018 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 222 MSNLKLCVEVVGAHDLMPKDGQGSCSAFVELHF 320 M NLKL V+VVGAHDLMPKDGQGS +AFVELHF Sbjct: 1 MGNLKLAVDVVGAHDLMPKDGQGSANAFVELHF 33 >ref|XP_011656335.1| PREDICTED: uncharacterized protein LOC101203632 [Cucumis sativus] gi|778709051|ref|XP_011656336.1| PREDICTED: uncharacterized protein LOC101203632 [Cucumis sativus] gi|700190444|gb|KGN45648.1| hypothetical protein Csa_6G003400 [Cucumis sativus] Length = 1018 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 222 MSNLKLCVEVVGAHDLMPKDGQGSCSAFVELHF 320 M NLKL V+VVGAHDLMPKDGQGS +AFVELHF Sbjct: 1 MGNLKLAVDVVGAHDLMPKDGQGSANAFVELHF 33 >ref|XP_012574181.1| PREDICTED: LOW QUALITY PROTEIN: protein QUIRKY-like [Cicer arietinum] Length = 997 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 222 MSNLKLCVEVVGAHDLMPKDGQGSCSAFVELHF 320 MSNLKL VEVVGAHDLMPKDG+GS S FVELHF Sbjct: 1 MSNLKLGVEVVGAHDLMPKDGEGSSSVFVELHF 33 >ref|XP_002511838.1| synaptotagmin, putative [Ricinus communis] gi|223549018|gb|EEF50507.1| synaptotagmin, putative [Ricinus communis] Length = 1017 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 222 MSNLKLCVEVVGAHDLMPKDGQGSCSAFVELHF 320 M+NL+L VEVVGAHDLMPKDGQGS SAFVE+HF Sbjct: 1 MNNLRLGVEVVGAHDLMPKDGQGSASAFVEIHF 33 >ref|XP_002301353.2| hypothetical protein POPTR_0002s15950g [Populus trichocarpa] gi|550345115|gb|EEE80626.2| hypothetical protein POPTR_0002s15950g [Populus trichocarpa] Length = 1008 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = +3 Query: 222 MSNLKLCVEVVGAHDLMPKDGQGSCSAFVELHF 320 MSNLKL VEVVGAHDLM KDGQGS SAFVELHF Sbjct: 1 MSNLKLGVEVVGAHDLMAKDGQGSASAFVELHF 33 >ref|XP_008775338.1| PREDICTED: uncharacterized protein LOC103695724 [Phoenix dactylifera] Length = 1003 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 222 MSNLKLCVEVVGAHDLMPKDGQGSCSAFVELHF 320 M+NLKL VEVVGAHDLMPKDGQGS +A+VELHF Sbjct: 1 MNNLKLGVEVVGAHDLMPKDGQGSANAYVELHF 33 >emb|CBI40337.3| unnamed protein product [Vitis vinifera] Length = 640 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 222 MSNLKLCVEVVGAHDLMPKDGQGSCSAFVELHF 320 MSNLKL VEVV AH+LMPKDGQGS SAFVELHF Sbjct: 1 MSNLKLGVEVVSAHNLMPKDGQGSASAFVELHF 33 >ref|XP_002271590.1| PREDICTED: uncharacterized protein LOC100253432 [Vitis vinifera] Length = 1018 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 222 MSNLKLCVEVVGAHDLMPKDGQGSCSAFVELHF 320 MSNLKL VEVV AH+LMPKDGQGS SAFVELHF Sbjct: 1 MSNLKLGVEVVSAHNLMPKDGQGSASAFVELHF 33 >emb|CAN79812.1| hypothetical protein VITISV_018822 [Vitis vinifera] Length = 1020 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 222 MSNLKLCVEVVGAHDLMPKDGQGSCSAFVELHF 320 MSNLKL VEVV AH+LMPKDGQGS SAFVELHF Sbjct: 1 MSNLKLGVEVVSAHNLMPKDGQGSASAFVELHF 33 >gb|KNA10051.1| hypothetical protein SOVF_148000 [Spinacia oleracea] Length = 1015 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 222 MSNLKLCVEVVGAHDLMPKDGQGSCSAFVELHF 320 M+NLKL V+VV AHDLMPKDGQGS SAFVELHF Sbjct: 1 MNNLKLGVDVVSAHDLMPKDGQGSSSAFVELHF 33 >ref|XP_011092017.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105172331 [Sesamum indicum] Length = 1001 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 222 MSNLKLCVEVVGAHDLMPKDGQGSCSAFVELHF 320 MSNLKL VEVV AH+LMPKDGQGS +AFVELHF Sbjct: 1 MSNLKLAVEVVRAHNLMPKDGQGSSNAFVELHF 33 >ref|XP_010672799.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1-like [Beta vulgaris subsp. vulgaris] gi|731312147|ref|XP_010672802.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1-like [Beta vulgaris subsp. vulgaris] gi|870869958|gb|KMT20703.1| hypothetical protein BVRB_1g006780 [Beta vulgaris subsp. vulgaris] Length = 1007 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 216 LAMSNLKLCVEVVGAHDLMPKDGQGSCSAFVELHF 320 + M+NLKL V VVGAHDLMPKDG GS SAFVELHF Sbjct: 1 MTMNNLKLGVHVVGAHDLMPKDGLGSSSAFVELHF 35