BLASTX nr result
ID: Wisteria21_contig00025266
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00025266 (229 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014518515.1| PREDICTED: uncharacterized protein LOC106775... 58 2e-06 gb|KOM41396.1| hypothetical protein LR48_Vigan04g159400 [Vigna a... 58 2e-06 >ref|XP_014518515.1| PREDICTED: uncharacterized protein LOC106775822 [Vigna radiata var. radiata] Length = 1163 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = -3 Query: 227 ERDSGMKDHRKGKDESVAGKGPRDSGLSEKRKLNSRSGTGNEEHSDEYSSS 75 ERDSG KD R+ K+ES + K +DSG EKR+L+S+ GN E+SDEY+SS Sbjct: 24 ERDSGAKD-RRSKEESGSAKASKDSGSGEKRRLDSKEAHGNGEYSDEYASS 73 >gb|KOM41396.1| hypothetical protein LR48_Vigan04g159400 [Vigna angularis] Length = 179 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = -3 Query: 227 ERDSGMKDHRKGKDESVAGKGPRDSGLSEKRKLNSRSGTGNEEHSDEYSSS 75 ERDSG KD R+ K+ES + K +DSG EKR+L+S+ GN E+SDEY+SS Sbjct: 24 ERDSGAKD-RRSKEESGSAKASKDSGSGEKRRLDSKEAHGNGEYSDEYASS 73